Basic Information | |
---|---|
Family ID | F023225 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 211 |
Average Sequence Length | 39 residues |
Representative Sequence | DGEVLHGDHVVVDADKKAGKMKFEVSQRVGEKEPAKAKR |
Number of Associated Samples | 179 |
Number of Associated Scaffolds | 211 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 97.63 % |
% of genes from short scaffolds (< 2000 bps) | 88.63 % |
Associated GOLD sequencing projects | 170 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.095 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.479 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.223 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.972 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.90% Coil/Unstructured: 79.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 211 Family Scaffolds |
---|---|---|
PF00753 | Lactamase_B | 9.00 |
PF05496 | RuvB_N | 7.11 |
PF02678 | Pirin | 2.84 |
PF01979 | Amidohydro_1 | 1.90 |
PF06439 | 3keto-disac_hyd | 1.90 |
PF01134 | GIDA | 1.42 |
PF14833 | NAD_binding_11 | 0.95 |
PF07228 | SpoIIE | 0.95 |
PF01713 | Smr | 0.95 |
PF00378 | ECH_1 | 0.95 |
PF09723 | Zn-ribbon_8 | 0.95 |
PF00437 | T2SSE | 0.95 |
PF08244 | Glyco_hydro_32C | 0.95 |
PF01434 | Peptidase_M41 | 0.95 |
PF13561 | adh_short_C2 | 0.95 |
PF14520 | HHH_5 | 0.47 |
PF00719 | Pyrophosphatase | 0.47 |
PF04307 | YdjM | 0.47 |
PF00581 | Rhodanese | 0.47 |
PF00962 | A_deaminase | 0.47 |
PF06480 | FtsH_ext | 0.47 |
PF04413 | Glycos_transf_N | 0.47 |
PF00108 | Thiolase_N | 0.47 |
PF01522 | Polysacc_deac_1 | 0.47 |
PF02801 | Ketoacyl-synt_C | 0.47 |
PF13620 | CarboxypepD_reg | 0.47 |
PF12631 | MnmE_helical | 0.47 |
PF07238 | PilZ | 0.47 |
PF01842 | ACT | 0.47 |
PF02826 | 2-Hacid_dh_C | 0.47 |
PF00389 | 2-Hacid_dh | 0.47 |
PF05163 | DinB | 0.47 |
PF07724 | AAA_2 | 0.47 |
PF10672 | Methyltrans_SAM | 0.47 |
PF13521 | AAA_28 | 0.47 |
PF10396 | TrmE_N | 0.47 |
PF01850 | PIN | 0.47 |
PF04237 | YjbR | 0.47 |
PF06348 | DUF1059 | 0.47 |
PF06067 | DUF932 | 0.47 |
PF11906 | DUF3426 | 0.47 |
PF03331 | LpxC | 0.47 |
PF01424 | R3H | 0.47 |
PF01594 | AI-2E_transport | 0.47 |
PF06769 | YoeB_toxin | 0.47 |
PF00930 | DPPIV_N | 0.47 |
PF01066 | CDP-OH_P_transf | 0.47 |
PF01012 | ETF | 0.47 |
PF13520 | AA_permease_2 | 0.47 |
PF00881 | Nitroreductase | 0.47 |
PF01207 | Dus | 0.47 |
PF16889 | Hepar_II_III_N | 0.47 |
PF03061 | 4HBT | 0.47 |
COG ID | Name | Functional Category | % Frequency in 211 Family Scaffolds |
---|---|---|---|
COG2255 | Holliday junction resolvasome RuvABC, ATP-dependent DNA helicase subunit RuvB | Replication, recombination and repair [L] | 7.11 |
COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 2.84 |
COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.42 |
COG1621 | Sucrose-6-phosphate hydrolase SacC, GH32 family | Carbohydrate transport and metabolism [G] | 0.95 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.47 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.47 |
COG0221 | Inorganic pyrophosphatase | Energy production and conversion [C] | 0.47 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.47 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.47 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0774 | UDP-3-O-acyl-N-acetylglucosamine deacetylase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.47 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.47 |
COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.47 |
COG1519 | 3-deoxy-D-manno-octulosonic-acid transferase | Cell wall/membrane/envelope biogenesis [M] | 0.47 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.47 |
COG1847 | Predicted RNA-binding protein Jag (SpoIIIJ-associated), conains KH and R3H domains | General function prediction only [R] | 0.47 |
COG1988 | Membrane-bound metal-dependent hydrolase YbcI, DUF457 family | General function prediction only [R] | 0.47 |
COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.47 |
COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.47 |
COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 0.47 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.47 |
COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.47 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.47 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.57 % |
Unclassified | root | N/A | 19.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459014|G1P06HT01BWT8M | Not Available | 573 | Open in IMG/M |
2170459024|GZRSKLJ02GML8R | Not Available | 503 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100247883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 518 | Open in IMG/M |
3300000789|JGI1027J11758_12162462 | Not Available | 591 | Open in IMG/M |
3300000789|JGI1027J11758_12475869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → Nevskia → Nevskia soli | 574 | Open in IMG/M |
3300000789|JGI1027J11758_12510288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 579 | Open in IMG/M |
3300001144|JGI12645J13327_102426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100691752 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1018 | Open in IMG/M |
3300001401|JGI20189J14885_1001108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8005 | Open in IMG/M |
3300001661|JGI12053J15887_10422225 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300004080|Ga0062385_10203775 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
3300004091|Ga0062387_101276273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium huanghuaihaiense | 579 | Open in IMG/M |
3300004092|Ga0062389_100150994 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
3300004092|Ga0062389_103832438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 565 | Open in IMG/M |
3300004152|Ga0062386_100047212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3235 | Open in IMG/M |
3300004480|Ga0062592_101027046 | Not Available | 756 | Open in IMG/M |
3300005171|Ga0066677_10494047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 703 | Open in IMG/M |
3300005332|Ga0066388_100919887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1450 | Open in IMG/M |
3300005332|Ga0066388_102477293 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300005335|Ga0070666_10677076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 755 | Open in IMG/M |
3300005434|Ga0070709_10620446 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300005435|Ga0070714_102492318 | Not Available | 502 | Open in IMG/M |
3300005438|Ga0070701_10245201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1079 | Open in IMG/M |
3300005445|Ga0070708_100106935 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
3300005455|Ga0070663_100150472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1784 | Open in IMG/M |
3300005459|Ga0068867_100309227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1305 | Open in IMG/M |
3300005529|Ga0070741_10440480 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
3300005529|Ga0070741_11585576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 537 | Open in IMG/M |
3300005533|Ga0070734_10367222 | Not Available | 821 | Open in IMG/M |
3300005602|Ga0070762_10009208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 4907 | Open in IMG/M |
3300005712|Ga0070764_10937889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
3300005764|Ga0066903_103978703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 793 | Open in IMG/M |
3300005904|Ga0075280_10055373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 764 | Open in IMG/M |
3300005921|Ga0070766_10005693 | All Organisms → cellular organisms → Bacteria | 6298 | Open in IMG/M |
3300005921|Ga0070766_10187814 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1286 | Open in IMG/M |
3300005921|Ga0070766_10285495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
3300005921|Ga0070766_10893940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 608 | Open in IMG/M |
3300006028|Ga0070717_12131323 | Not Available | 504 | Open in IMG/M |
3300006059|Ga0075017_100875996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
3300006102|Ga0075015_100291061 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 896 | Open in IMG/M |
3300006163|Ga0070715_10634244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
3300006175|Ga0070712_100990456 | Not Available | 727 | Open in IMG/M |
3300006176|Ga0070765_100093741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 2579 | Open in IMG/M |
3300006176|Ga0070765_101383063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 663 | Open in IMG/M |
3300006176|Ga0070765_101913412 | Not Available | 555 | Open in IMG/M |
3300006354|Ga0075021_11074733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300006358|Ga0068871_101753085 | Not Available | 589 | Open in IMG/M |
3300006796|Ga0066665_11506470 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
3300006800|Ga0066660_10796443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 770 | Open in IMG/M |
3300006806|Ga0079220_10901701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 686 | Open in IMG/M |
3300006893|Ga0073928_10024469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6039 | Open in IMG/M |
3300006893|Ga0073928_10715587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 697 | Open in IMG/M |
3300006893|Ga0073928_11175640 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300006954|Ga0079219_10762677 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300009012|Ga0066710_102148948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
3300009012|Ga0066710_102192433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 807 | Open in IMG/M |
3300009093|Ga0105240_10484220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1379 | Open in IMG/M |
3300009521|Ga0116222_1260315 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300009524|Ga0116225_1229804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
3300009624|Ga0116105_1071066 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
3300009632|Ga0116102_1128811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
3300009636|Ga0116112_1217083 | Not Available | 531 | Open in IMG/M |
3300009665|Ga0116135_1120907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 961 | Open in IMG/M |
3300009698|Ga0116216_10042313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2818 | Open in IMG/M |
3300009792|Ga0126374_11508346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
3300010043|Ga0126380_11924474 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300010048|Ga0126373_11462381 | Not Available | 749 | Open in IMG/M |
3300010321|Ga0134067_10131826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 879 | Open in IMG/M |
3300010322|Ga0134084_10468110 | Not Available | 505 | Open in IMG/M |
3300010341|Ga0074045_10494243 | Not Available | 787 | Open in IMG/M |
3300010358|Ga0126370_10323100 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
3300010360|Ga0126372_12258718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
3300010366|Ga0126379_11934666 | Not Available | 693 | Open in IMG/M |
3300010366|Ga0126379_13605256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300010376|Ga0126381_101640529 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300010376|Ga0126381_104086354 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300010376|Ga0126381_105149141 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010379|Ga0136449_102756528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
3300011271|Ga0137393_10906889 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
3300012096|Ga0137389_10218690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1592 | Open in IMG/M |
3300012096|Ga0137389_11220194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
3300012189|Ga0137388_11506109 | Not Available | 610 | Open in IMG/M |
3300012199|Ga0137383_10487977 | Not Available | 902 | Open in IMG/M |
3300012207|Ga0137381_11665880 | Not Available | 528 | Open in IMG/M |
3300012210|Ga0137378_10751759 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
3300012350|Ga0137372_10365115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1102 | Open in IMG/M |
3300012351|Ga0137386_10403395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300012351|Ga0137386_11252211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300012354|Ga0137366_10525040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
3300012360|Ga0137375_10696267 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
3300012363|Ga0137390_10510460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1175 | Open in IMG/M |
3300012532|Ga0137373_10604288 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300012917|Ga0137395_11152619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
3300012918|Ga0137396_10538493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
3300012955|Ga0164298_11173317 | Not Available | 580 | Open in IMG/M |
3300012971|Ga0126369_11602420 | Not Available | 741 | Open in IMG/M |
3300012971|Ga0126369_13373610 | Not Available | 523 | Open in IMG/M |
3300013100|Ga0157373_11307142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
3300013105|Ga0157369_10270612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1770 | Open in IMG/M |
3300013307|Ga0157372_13160993 | Not Available | 525 | Open in IMG/M |
3300014159|Ga0181530_10671575 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300014168|Ga0181534_10416863 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
3300014325|Ga0163163_13118808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
3300014491|Ga0182014_10133309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1430 | Open in IMG/M |
3300014654|Ga0181525_10361295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300015054|Ga0137420_1371937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1399 | Open in IMG/M |
3300016294|Ga0182041_11075843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
3300016341|Ga0182035_11206476 | Not Available | 676 | Open in IMG/M |
3300016371|Ga0182034_12047293 | Not Available | 506 | Open in IMG/M |
3300017823|Ga0187818_10099110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
3300017941|Ga0187850_10486166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300017943|Ga0187819_10020385 | All Organisms → cellular organisms → Bacteria | 3854 | Open in IMG/M |
3300017943|Ga0187819_10146269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
3300017943|Ga0187819_10227384 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300017943|Ga0187819_10437750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
3300017974|Ga0187777_10002250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 12394 | Open in IMG/M |
3300017975|Ga0187782_10109650 | All Organisms → cellular organisms → Bacteria | 2035 | Open in IMG/M |
3300017975|Ga0187782_10637242 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300017994|Ga0187822_10000953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5621 | Open in IMG/M |
3300017998|Ga0187870_1329574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
3300018009|Ga0187884_10442174 | Not Available | 523 | Open in IMG/M |
3300018012|Ga0187810_10220550 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
3300018023|Ga0187889_10187358 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
3300018025|Ga0187885_10044427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 2311 | Open in IMG/M |
3300018025|Ga0187885_10078604 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300018034|Ga0187863_10549778 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
3300018040|Ga0187862_10623257 | Not Available | 637 | Open in IMG/M |
3300018044|Ga0187890_10113671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1567 | Open in IMG/M |
3300018064|Ga0187773_10241320 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300018088|Ga0187771_10845376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 776 | Open in IMG/M |
3300018090|Ga0187770_11291707 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300018468|Ga0066662_10804336 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300019888|Ga0193751_1004491 | All Organisms → cellular organisms → Bacteria | 7962 | Open in IMG/M |
3300020583|Ga0210401_11451699 | Not Available | 543 | Open in IMG/M |
3300021170|Ga0210400_11204887 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
3300021403|Ga0210397_10241755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1307 | Open in IMG/M |
3300021406|Ga0210386_11207956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
3300021420|Ga0210394_11139244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
3300021432|Ga0210384_10319753 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300021559|Ga0210409_10627808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 944 | Open in IMG/M |
3300024331|Ga0247668_1097654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300025406|Ga0208035_1007790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1732 | Open in IMG/M |
3300025664|Ga0208849_1000041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 124712 | Open in IMG/M |
3300025903|Ga0207680_10853125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300025906|Ga0207699_10263517 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
3300025911|Ga0207654_10674771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
3300025914|Ga0207671_10629158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
3300025928|Ga0207700_11796254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
3300025986|Ga0207658_10216822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1607 | Open in IMG/M |
3300026295|Ga0209234_1113348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
3300026309|Ga0209055_1015281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3848 | Open in IMG/M |
3300026322|Ga0209687_1248906 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300026335|Ga0209804_1190952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 871 | Open in IMG/M |
3300026550|Ga0209474_10162831 | All Organisms → cellular organisms → Bacteria | 1445 | Open in IMG/M |
3300026550|Ga0209474_10208819 | Not Available | 1238 | Open in IMG/M |
3300026557|Ga0179587_11108523 | Not Available | 521 | Open in IMG/M |
3300027559|Ga0209222_1100762 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300027825|Ga0209039_10186333 | Not Available | 849 | Open in IMG/M |
3300027826|Ga0209060_10380297 | Not Available | 643 | Open in IMG/M |
3300027857|Ga0209166_10004096 | All Organisms → cellular organisms → Bacteria | 10304 | Open in IMG/M |
3300027884|Ga0209275_10068069 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1756 | Open in IMG/M |
3300027903|Ga0209488_10732855 | Not Available | 706 | Open in IMG/M |
3300027905|Ga0209415_10934322 | Not Available | 585 | Open in IMG/M |
3300027905|Ga0209415_11131087 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300027911|Ga0209698_10566917 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300028536|Ga0137415_10848679 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300028558|Ga0265326_10103821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
3300028766|Ga0302269_1107840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 816 | Open in IMG/M |
3300028798|Ga0302222_10438921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300028906|Ga0308309_10793058 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300029915|Ga0311358_11149235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300029945|Ga0311330_10771936 | Not Available | 732 | Open in IMG/M |
3300029951|Ga0311371_10276380 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2395 | Open in IMG/M |
3300029952|Ga0311346_11426816 | Not Available | 522 | Open in IMG/M |
3300029953|Ga0311343_10705714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
3300030003|Ga0302172_10042385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
3300030007|Ga0311338_10336505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1649 | Open in IMG/M |
3300030007|Ga0311338_11150466 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300030043|Ga0302306_10413083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300030054|Ga0302182_10160724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300030058|Ga0302179_10174468 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
3300030507|Ga0302192_10289562 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
3300030740|Ga0265460_11095508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 749 | Open in IMG/M |
3300030760|Ga0265762_1035664 | Not Available | 958 | Open in IMG/M |
3300030760|Ga0265762_1130389 | Not Available | 583 | Open in IMG/M |
3300031231|Ga0170824_116102468 | Not Available | 652 | Open in IMG/M |
3300031232|Ga0302323_101715059 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
3300031236|Ga0302324_103014102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
3300031525|Ga0302326_10239488 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2972 | Open in IMG/M |
3300031525|Ga0302326_11487562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 908 | Open in IMG/M |
3300031715|Ga0307476_10220461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1380 | Open in IMG/M |
3300031716|Ga0310813_10517260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
3300031718|Ga0307474_10846794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
3300031740|Ga0307468_100091510 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
3300031954|Ga0306926_10231844 | All Organisms → cellular organisms → Bacteria | 2290 | Open in IMG/M |
3300031962|Ga0307479_10510283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1186 | Open in IMG/M |
3300032089|Ga0318525_10391580 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 712 | Open in IMG/M |
3300032180|Ga0307471_100044269 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3603 | Open in IMG/M |
3300032180|Ga0307471_101604736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 806 | Open in IMG/M |
3300032205|Ga0307472_100131878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1789 | Open in IMG/M |
3300032770|Ga0335085_11326060 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300032805|Ga0335078_12473512 | Not Available | 537 | Open in IMG/M |
3300032828|Ga0335080_12333538 | Not Available | 511 | Open in IMG/M |
3300032892|Ga0335081_10350518 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → unclassified Thermoproteota → Crenarchaeota archaeon 13_1_20CM_2_51_8 | 1924 | Open in IMG/M |
3300032892|Ga0335081_11759236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 673 | Open in IMG/M |
3300033004|Ga0335084_11657247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
3300033158|Ga0335077_11198685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300033158|Ga0335077_11712312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 594 | Open in IMG/M |
3300033887|Ga0334790_221743 | Not Available | 534 | Open in IMG/M |
3300033983|Ga0371488_0068304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2093 | Open in IMG/M |
3300034163|Ga0370515_0041636 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.21% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.21% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.74% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.79% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.32% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.32% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.84% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.84% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.84% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.84% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.37% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.37% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.37% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.90% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.42% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.42% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.42% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.42% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.95% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.95% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.95% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.47% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.47% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.47% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.47% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.47% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.47% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.47% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.47% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.47% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.47% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.47% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.47% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001144 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O1 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001401 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005904 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_404 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009632 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025664 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300028766 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2 | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
2PV_03667930 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | LDGEVLHGDHIVVDADKKGGKMMFTVSERVGEKAPAKR |
FD1_08710080 | 2170459024 | Grass Soil | MAKVLHGDHVIVDVDKKAGKLKFEVSERVGEKKPAKSKA |
INPhiseqgaiiFebDRAFT_1002478832 | 3300000364 | Soil | DGEVLHGDHVIVDADKKAGKLTFKVSKRVGEKEPAKVR* |
JGI1027J11758_121624621 | 3300000789 | Soil | DGEVLHGDHVIVDVDKKAGKLNFEVSERVGEKKPAKSKA* |
JGI1027J11758_124758691 | 3300000789 | Soil | DGAVLHGDHLVVDADKKAGMMTFAVSKRVGEKEPARSR* |
JGI1027J11758_125102882 | 3300000789 | Soil | DGAVLHGDHLEVHADKKAGKMVFAVSKRVGEKEPARSR* |
JGI12645J13327_1024262 | 3300001144 | Forest Soil | ILHGDHVIVEADKKAGKMKFEVSKRVREKEPVKAKV* |
JGIcombinedJ13530_1006917522 | 3300001213 | Wetland | KILDGEVLHGDHIVVDADKKAGKLTFKVAKRVGEPAVVTN* |
JGI20189J14885_10011086 | 3300001401 | Arctic Peat Soil | MKILDGEVLRGDHIVVDARAGKVKFEISQRVGNREPTTPIGSM* |
JGI12053J15887_104222252 | 3300001661 | Forest Soil | GEILNGDHVIVDADKRLGKMTFAISKRVGEKEPAKAKR* |
Ga0062385_102037753 | 3300004080 | Bog Forest Soil | DGEILHGDHVIIDADKKAGKMKFEVSKRVGEKEPVKAKR* |
Ga0062387_1012762732 | 3300004091 | Bog Forest Soil | ALKILDGEVLHGDHMIVDADKKTGKMIFKASERVGAKDPAKAKK* |
Ga0062389_1001509942 | 3300004092 | Bog Forest Soil | LHGDHVVVDADKKTDKMTFKVSERVGKKEATAKASSRKG* |
Ga0062389_1038324382 | 3300004092 | Bog Forest Soil | ILDGQVLHGDHVVVDADKKAGKMTFVVSERVGEAKAAKSKK* |
Ga0062386_1000472123 | 3300004152 | Bog Forest Soil | KILDGEVLHGDHVVVDVDKKQRKLSFKVAKRVGEPEPATAKK* |
Ga0062592_1010270463 | 3300004480 | Soil | LDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPAKARR* |
Ga0066677_104940472 | 3300005171 | Soil | KILDGEILHGDHVIVDADKRTGKIIIEVSKRVGEKEPAKLKRA* |
Ga0066388_1009198871 | 3300005332 | Tropical Forest Soil | KILDGEVLHGDHVIVDADKKAGKLKFEVSERVGQKQPATK* |
Ga0066388_1024772931 | 3300005332 | Tropical Forest Soil | KILDGEVLHGDHVVVDAKDGKVQFAVSKRVGERQPTSTAK* |
Ga0070666_106770761 | 3300005335 | Switchgrass Rhizosphere | ILDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPVKARR* |
Ga0070709_106204462 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | KILDGQVLHGDHAVVDADKRTGKMTFAVSRRHGEKPVQEKPQPAAKS* |
Ga0070714_1024923181 | 3300005435 | Agricultural Soil | LRILDGEVLHGDHVIVDVDKKAGKLKFEVSERVGEKKPAKSKA* |
Ga0070701_102452011 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ALKILDGEVLHGDHVVVDAKNGKMQFEVSKRIGAKEPIAAP* |
Ga0070708_1001069354 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | KILDGEVLHGDHVIVDADKNAGKMKFEISQRVGEKEPAKAKR* |
Ga0070663_1001504721 | 3300005455 | Corn Rhizosphere | ILDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPAKARR* |
Ga0068867_1003092271 | 3300005459 | Miscanthus Rhizosphere | LDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPVKARR* |
Ga0070741_104404803 | 3300005529 | Surface Soil | ILDGEVLHGDHVVVDADPQQRQAVFKVSKRVGEPVAK* |
Ga0070741_115855762 | 3300005529 | Surface Soil | LDGEVLHGDHVVVDAQGGKMQFQVSHRVGEPVEAKR* |
Ga0070734_103672221 | 3300005533 | Surface Soil | LDGEVLQGDHVIVDADKRTGKMKFEVSERVGEKQPVKAKR* |
Ga0070762_100092081 | 3300005602 | Soil | HGDHVIVDADKKAGKMKFEVSRRVGEKEPVKVRR* |
Ga0070764_109378891 | 3300005712 | Soil | EVLHGDHIVVDADKKLGKMKFELSKRVGEKEPVKAKTK* |
Ga0066903_1039787032 | 3300005764 | Tropical Forest Soil | KILDGEVLHGDHVIVEADKRSGKVKFEVSKRVGAEEPAKVKR* |
Ga0075280_100553731 | 3300005904 | Rice Paddy Soil | KILDGEVLHGDHVVVDADTLEHKMVFQVSHRVGEKEPVEAKR* |
Ga0070766_100056931 | 3300005921 | Soil | LHGDHVIVDADKKAGKMKFEVSRRVGEDEPVQAKK* |
Ga0070766_101878144 | 3300005921 | Soil | GEVLHGDHVIVDADKKAGKMKFEVSRRVGEKEPVKVRR* |
Ga0070766_102854951 | 3300005921 | Soil | VLHGDHVIVDGDKKTGKMKFEVSRRVGEQEPVKAKR* |
Ga0070766_108939402 | 3300005921 | Soil | KILDGEVLHGDHVIVDADKRAGKMVIQVSRHSAKETAKAKA* |
Ga0070717_121313231 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GEVLHGDHLVVDADKRAGKMIFTVSKRVGEKEPAKTRK* |
Ga0075017_1008759962 | 3300006059 | Watersheds | HGDHIVVDADKKAGNLKFEVSKRVREKEPANAKR* |
Ga0075015_1002910611 | 3300006102 | Watersheds | LKILDGEVLHGDHVIVDSDKKAGKMKFEVSPRVGEKETARAKR* |
Ga0070715_106342441 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EVLHGDHVVVDADKKAGKMMFEVSKRVGEREPAKARE* |
Ga0070712_1009904561 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | ILDGEVLHGDHVVVDAAKGKMQFKVSHRVGEKEPTAAR* |
Ga0070765_1000937414 | 3300006176 | Soil | ILDGEILHGDHVIVDADKKSGKMNFEVSKRVGEKEPVKTKR* |
Ga0070765_1013830632 | 3300006176 | Soil | GEVLHGDHVIVDADKKAGKLTFQVSKRVGEKVPAASKR* |
Ga0070765_1019134122 | 3300006176 | Soil | DGEILHGDHVIVDADKKAGKMKFEVSKRVGEKEPTKARR* |
Ga0075021_110747331 | 3300006354 | Watersheds | ILDGEVLYGDHVVVDADKKAGKMTFAVSKRVGEKEPAKAKR* |
Ga0068871_1017530852 | 3300006358 | Miscanthus Rhizosphere | KILDGEVLHGDHVVVDAAKGKMQFKVSHRVGEKEPTAAR* |
Ga0066665_115064702 | 3300006796 | Soil | HGDHVVVDADKGAGKMVFEVSKRVGEKKEPAKTRR* |
Ga0066660_107964431 | 3300006800 | Soil | EILHGDHVIVDADKRTGKIIIEVSKRVGEKEPAKLKRA* |
Ga0079220_109017012 | 3300006806 | Agricultural Soil | LDGEVLHGDHVIVDADKRSGKLTFKVSERVGEKGPVRAKR* |
Ga0073928_100244691 | 3300006893 | Iron-Sulfur Acid Spring | ILDGEILHGDHVIVDADKKAGKMKFEVSKRVREKEPVKATS* |
Ga0073928_107155872 | 3300006893 | Iron-Sulfur Acid Spring | GEVLHGDHVVVDADAGKIKFTVSERVREPAPAVR* |
Ga0073928_111756401 | 3300006893 | Iron-Sulfur Acid Spring | ILDGEILHGDHVIVDADKKAGKMKFEVSKRVREKEPVKATL* |
Ga0079219_107626773 | 3300006954 | Agricultural Soil | DGEVLHGDHVIVDAKNGKMQFEVSRRVGQPVRSGR* |
Ga0066710_1021489481 | 3300009012 | Grasslands Soil | DGEILHGDHVIVDADKRTGKIIIEVSRRVGEKEPAKLRRA |
Ga0066710_1021924332 | 3300009012 | Grasslands Soil | LDGEVLHGDHTVVDADKGNGKLRFEVSRRVGEPVKPAC |
Ga0105240_104842203 | 3300009093 | Corn Rhizosphere | LDGEVLHGDHVVVDAKAGKMQFQVSHRVGEPVEAKR* |
Ga0116222_12603152 | 3300009521 | Peatlands Soil | ALKILDGAVLHADHVIVDADKKAGKMTFKVSERVGGKETARAKK* |
Ga0116225_12298043 | 3300009524 | Peatlands Soil | LDGEVLHGDHIIVEADKKTGKMKFEISPRVGEKEPAKAKTK* |
Ga0116105_10710661 | 3300009624 | Peatland | EILHGDHIVVDADKKAGKMKFEVSQRVGEKEPAKAKR* |
Ga0116102_11288112 | 3300009632 | Peatland | ILDGEVLHGDHVIVDADKNAGKMTFKVSERVREKEPARAKK* |
Ga0116112_12170832 | 3300009636 | Peatland | LHGDHVIVDADKNAGKMTFKVSERVREKEPARAKK* |
Ga0116135_11209071 | 3300009665 | Peatland | ILDGEILHGDHVVIDADKKAGKMTFEVSKRVGQKEKVKAK* |
Ga0116216_100423134 | 3300009698 | Peatlands Soil | AVLHGDHVIVDADKKAGKMTFKVSERVGEKATARAKK* |
Ga0126374_115083462 | 3300009792 | Tropical Forest Soil | KILDGEVLHGDHVVVEAREGKMKFQVSKRIGEPMKAAK* |
Ga0126380_119244741 | 3300010043 | Tropical Forest Soil | MKILDGQVLHGDHVIVDADKKAGKLKFEVSERVGLKEPARK* |
Ga0126373_114623811 | 3300010048 | Tropical Forest Soil | ILDGEVLHGDHVVVDADKKQHKLTFKVAKRVGEPAPTPAK* |
Ga0134067_101318261 | 3300010321 | Grasslands Soil | GEVLHGDHVVVDAEKSSGKMKFQVSRRVGEPAPTLRS* |
Ga0134084_104681102 | 3300010322 | Grasslands Soil | HGDHVVVDADKRAAKMTFEVSKRVGEKEPAKARR* |
Ga0074045_104942431 | 3300010341 | Bog Forest Soil | KILDGEILHGDHIVVDADKKAGKMKFEVSQRVGEKEPAKAKR* |
Ga0126370_103231003 | 3300010358 | Tropical Forest Soil | LHGDHVIVEADKKAGKMIFEVSKRMGEKEPAKARR* |
Ga0126372_122587182 | 3300010360 | Tropical Forest Soil | EVLHGDHVVVDAKQGKMQFEVSRTVPQKEVAGVTK* |
Ga0126379_119346662 | 3300010366 | Tropical Forest Soil | KILDGEVLHGDHVIVDADKKKHQLTFKVAKRVGEPAVAVK* |
Ga0126379_136052561 | 3300010366 | Tropical Forest Soil | KILDGEVLHGDHLVVGVDKKSGKMTFTVSQRVGEKVPAKVR* |
Ga0126381_1016405291 | 3300010376 | Tropical Forest Soil | VLHGDHVVVDGDKKAGRMQFSVSKRVGEKEPAKARK* |
Ga0126381_1040863542 | 3300010376 | Tropical Forest Soil | LDGEVLHGDHVIVDAKNGTMQFAVSPRVGEPVKSGR* |
Ga0126381_1051491411 | 3300010376 | Tropical Forest Soil | VLHGDHVVVDADKKAGTMTLAVSQRVGEKAPAKAKR* |
Ga0136449_1027565282 | 3300010379 | Peatlands Soil | DGEVLHGDHVVVDADKRTGKMIVSVSQRVREKEPTKAR* |
Ga0137393_109068891 | 3300011271 | Vadose Zone Soil | KILDGAVLHGDHVVVDADKKAGKMTFKVSERVGEKEPARAKK* |
Ga0137389_102186901 | 3300012096 | Vadose Zone Soil | LKILDGEVLHGDHVVVDADAGKIKFTVSERVREPAPTVR* |
Ga0137389_112201941 | 3300012096 | Vadose Zone Soil | ILHGDHVIADADKKAGKMKFEVSERVGQKESVKSKR* |
Ga0137388_115061093 | 3300012189 | Vadose Zone Soil | DGEVLHGDHVIVDADKRTGKMKFEVSKRVGEKEPAKARR* |
Ga0137383_104879772 | 3300012199 | Vadose Zone Soil | LDGEVLHGDHVVVDADKRTGKMTFEVSKRVGEREPAKARR* |
Ga0137381_116658801 | 3300012207 | Vadose Zone Soil | LHGDHVVVDADKRTGKMTFEVSKRVGENEPAKARR* |
Ga0137378_107517591 | 3300012210 | Vadose Zone Soil | ILHGDHVIVDADKKAGKMTFEVSKRVGEKEPAKAKR* |
Ga0137372_103651151 | 3300012350 | Vadose Zone Soil | KILDGEVLHGDHIVVDASKKAGVMKFEVSERVGEKEPAKAKR* |
Ga0137386_104033953 | 3300012351 | Vadose Zone Soil | GEVLHGDHVVVDVDKKTGKMKFEVSARVEAKTPAGTRE* |
Ga0137386_112522111 | 3300012351 | Vadose Zone Soil | GEHVVVDADEGAGKMVFEVSKRVGEKKEPAKTRR* |
Ga0137366_105250401 | 3300012354 | Vadose Zone Soil | ILDGEVLHGDHIVVDASKKAGVMKFEVSERVGEKEPARAKR* |
Ga0137375_106962671 | 3300012360 | Vadose Zone Soil | ILDGEVLHGDHVIVDADKKTGKMTFHVAHRVSAETGAPQAKR* |
Ga0137390_105104603 | 3300012363 | Vadose Zone Soil | LDGDVLHGDHVVVDADQKAGKMTFKVSERVGEKVGAQAKK* |
Ga0137373_106042881 | 3300012532 | Vadose Zone Soil | EVLHGDHVVVDAKDGKMTFDVSKRIGEKEPAKAR* |
Ga0137395_111526191 | 3300012917 | Vadose Zone Soil | ALKILDGEILHGDHIVVDVDKKAGKMKFEASKRVGEKEPAKAKR* |
Ga0137396_105384932 | 3300012918 | Vadose Zone Soil | LALKILDGEILNGDHIIVDADKKSSKMTFEVSRHKAEKEPAKARR* |
Ga0164298_111733172 | 3300012955 | Soil | AAPDLALGDHVIADADKKAGKMKFTVSKRVGQKEPAKTR* |
Ga0126369_116024202 | 3300012971 | Tropical Forest Soil | EILHGDHVIVDADKRGGKMTCKVSKRVREIQPAKAKK* |
Ga0126369_133736101 | 3300012971 | Tropical Forest Soil | HGDHVIVDADKKGGKMSFEVSPRVGQKQPAKSKR* |
Ga0157373_113071422 | 3300013100 | Corn Rhizosphere | VLHGDHVVADADKRSGKVKFEVSHRVGETVQPAR* |
Ga0157369_102706123 | 3300013105 | Corn Rhizosphere | LHGDHVVVDADKKAGKMVFEVSKRVGEKEPAKARR* |
Ga0157372_131609931 | 3300013307 | Corn Rhizosphere | LKILDGEVLHGDHVVVDAKKGKMQFEVSRRVGEPVRA* |
Ga0181530_106715751 | 3300014159 | Bog | VLHGDHVVVDADKKAGKMKFDVSKRVGEKEPAKAKR* |
Ga0181534_104168632 | 3300014168 | Bog | DGEVLHGDHIVVDADKKLGKMKFEVSRRVGEKEPAKAKSK* |
Ga0163163_131188082 | 3300014325 | Switchgrass Rhizosphere | LDGEVLHGDKIVVDADKKTGKLTFKVASRAAQPEPVAAK* |
Ga0182014_101333091 | 3300014491 | Bog | DGEVLHGDHVIVDADKKAGKMTFKVSERAGEKEPARAKK* |
Ga0181525_103612951 | 3300014654 | Bog | HGDHVIVDADKKTGKMTFKVSERVGEKQPARAKK* |
Ga0137420_13719371 | 3300015054 | Vadose Zone Soil | EVLHGDHVVVDADKKAGKMVFSVSERVGEQVPAKVKK* |
Ga0182041_110758431 | 3300016294 | Soil | EVLHGDHVVVDADKKTGKMVFEVSKRVGEKEPAKARR |
Ga0182035_112064761 | 3300016341 | Soil | KILDGEVLHGDHVIVEGDKKAGKMKFSVSKRVGEKEPPKAQR |
Ga0182034_120472932 | 3300016371 | Soil | GEVLHGDHVMVDADKKAGALKFKVAQRVGSAEPATVPGH |
Ga0187818_100991103 | 3300017823 | Freshwater Sediment | VLHGDHVIVDADKKADKMTFKVSKRVGEKEPAGAKK |
Ga0187850_104861661 | 3300017941 | Peatland | ILDGAVLHGDHVVVDADKKAGKMTFKVSERVGEKEAARAKK |
Ga0187819_100203855 | 3300017943 | Freshwater Sediment | GEILHGDHVIVDADKKAGKMTFEVSPRVGEKAPAKAKR |
Ga0187819_101462691 | 3300017943 | Freshwater Sediment | ILHGDHVIVDADTRAGKMKFDVSKRVGEKEPAKTRR |
Ga0187819_102273843 | 3300017943 | Freshwater Sediment | LHGDHIIVDADKKSGKMKFEVSKRVGEKEPAKARR |
Ga0187819_104377502 | 3300017943 | Freshwater Sediment | EVLHGDHVIVDADKKAGKMKFEVSRRVGEAEPVKAKK |
Ga0187777_100022501 | 3300017974 | Tropical Peatland | GEVLHGDHVVVDADRKAGKMKFEVSQRVGEKATTKTKR |
Ga0187782_101096503 | 3300017975 | Tropical Peatland | DGEVLHGDHVVVDADKKAGKMKFEVSQRVGEKEPAKAKR |
Ga0187782_106372422 | 3300017975 | Tropical Peatland | KILDGEVRHGDHVIVDADKMLSQLTFTVAPRVGEKESART |
Ga0187822_100009536 | 3300017994 | Freshwater Sediment | GEVLHGDHVVVDADKKAGKMAFEVSKRVGEKERARVRR |
Ga0187870_13295741 | 3300017998 | Peatland | VLHGDHIVVAADNKTGKMKFEVSQRVGEKETAKARR |
Ga0187884_104421743 | 3300018009 | Peatland | GEVLHGDHVVVDADKKDHKLTFKVAKRVGEPEPAAKK |
Ga0187810_102205502 | 3300018012 | Freshwater Sediment | GEVLHGDHVIVDADKKTGKMKFEVSKRVGEGEQVKARR |
Ga0187889_101873581 | 3300018023 | Peatland | VLHGDHVIVDADKKAGKMTFKVSERVGEKETARAKK |
Ga0187885_100444273 | 3300018025 | Peatland | VLHGDHITVDADKKQHKLTFKVAKRVGEPAKAAVK |
Ga0187885_100786041 | 3300018025 | Peatland | DGEILHGDHVIVDADKKAGKMTFNVSERVGEKETARAKK |
Ga0187863_105497781 | 3300018034 | Peatland | LHGDHLIVDADKKAGKMTFKVSKRVGEKVAAKART |
Ga0187862_106232572 | 3300018040 | Peatland | KILDGEVLHGDHAVVDADKKAGKLVFKVSERVGETAAAKK |
Ga0187890_101136713 | 3300018044 | Peatland | GEVLHGDHIVVDADKKLGKLKFEVSKRVGEKEPAKAKTK |
Ga0187773_102413204 | 3300018064 | Tropical Peatland | KILDGEVLNGDHVIVDADKRAGKMKFEVSKRVGEKEPVKARR |
Ga0187771_108453762 | 3300018088 | Tropical Peatland | DGEVLHGDHVIVDADKKAGTMKFEVSQRVGEKEPAKAKR |
Ga0187770_112917071 | 3300018090 | Tropical Peatland | GEILHGDHVIVDADKRAGKMKFEVSRHAVAKEPARARK |
Ga0066662_108043361 | 3300018468 | Grasslands Soil | DGEVLHGDHVIVDADKRSGKLTFKVSERVGEKGPVRAKR |
Ga0193751_100449110 | 3300019888 | Soil | LHGDHVIVDADKKAGKMVFEVSRRVGEKAPAKARR |
Ga0210401_114516991 | 3300020583 | Soil | LDGEVLHGDHVIVDADKKAGRMKFEVSKRVGEKEPVKARR |
Ga0210400_112048871 | 3300021170 | Soil | LKILDGEILHGDHVIVEADKRLGKMRFAISKRVGEKQPATAKR |
Ga0210397_102417554 | 3300021403 | Soil | GEILHGDHVIVDADKKAGKLTFEVSKRVGEKEPMKAKR |
Ga0210386_112079561 | 3300021406 | Soil | KILDGEVLHGDHVIVDADKRAGKMVFQVSRHAAKETAKAKA |
Ga0210394_111392442 | 3300021420 | Soil | DVLQGDHVIVDADKRTGKMKFEVSQRVGETQPVQAKR |
Ga0210384_103197531 | 3300021432 | Soil | DGEVLHGDHVIVDADKKAGKLTFQVSKRVGEKEPAASKR |
Ga0210409_106278083 | 3300021559 | Soil | GEVLHGDHVIVDADKKAGKMKFEVSRRVGEEEPVKAKK |
Ga0247668_10976542 | 3300024331 | Soil | EVLHGDHVVVDSDKKAGKMTFEVSKRVGETEPAKARR |
Ga0208035_10077903 | 3300025406 | Peatland | DGAILHGDHIIVDADKKAGKMKFEVSKRVGEKEPAKAKR |
Ga0208849_100004166 | 3300025664 | Arctic Peat Soil | MKILDGEVLRGDHIVVDARAGKVKFEISQRVGNREPTTPIGSM |
Ga0207680_108531252 | 3300025903 | Switchgrass Rhizosphere | ILDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPVKARR |
Ga0207699_102635171 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | KILDGQVLHGDHAVVDADKRTGKMTFAVSRRHGEKPVQEKPQPAAKS |
Ga0207654_106747712 | 3300025911 | Corn Rhizosphere | LDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPAKARR |
Ga0207671_106291581 | 3300025914 | Corn Rhizosphere | VLHGDHLVVDADKKAGKMTFAVSKRVGEKEPVRSQ |
Ga0207700_117962541 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | KILDGEVLHGDHIVVDAAKGKMQFQVSKRVGEEQVPARP |
Ga0207658_102168221 | 3300025986 | Switchgrass Rhizosphere | ILDGEVLHGDHVVVDADKKAGKMVFEVSKRVGEKEPAKARR |
Ga0209234_11133482 | 3300026295 | Grasslands Soil | KILDGEVLHGDHVIVDADKRTGKIIIEVSKRVGEKEPAKLRRA |
Ga0209055_10152816 | 3300026309 | Soil | GEVLHGDHVVVDADKRAAKMTFEVSKRVGENEPAKARR |
Ga0209687_12489061 | 3300026322 | Soil | GEVLHGDHIVVDADKKAGKMMFTVSQRVSQKAPAESKR |
Ga0209804_11909521 | 3300026335 | Soil | GEILHGDHVVADADKRTGKLKFEVSRRVGEPAPTRR |
Ga0209474_101628312 | 3300026550 | Soil | VLHGDHIVVDADKKAGKMMFTVSQRVSQKAPAESKR |
Ga0209474_102088192 | 3300026550 | Soil | DGEVLHGDHVVVDADKRTGKMTFEVSKRVGEKEPAKARR |
Ga0179587_111085232 | 3300026557 | Vadose Zone Soil | EILNGDHLIVDADQRLGKMRFAISKRVGEKEPAKAKR |
Ga0209222_11007621 | 3300027559 | Forest Soil | VLHGDHVIVDADNKTGRMTFKVSERVGEKVAARAKQ |
Ga0209039_101863331 | 3300027825 | Bog Forest Soil | DGEVLHGDHVIVDVDKKQRKLTFKVAKRVGEPEPVAKK |
Ga0209060_103802972 | 3300027826 | Surface Soil | ILDGEVLQGDHVIVDADKRTGKMKFEVSERVGEKQPVKAKR |
Ga0209166_1000409611 | 3300027857 | Surface Soil | LDGEVLHGDHVVVDADKKSGKMTFEVSERVGEKASAKSKQ |
Ga0209275_100680691 | 3300027884 | Soil | DGEVLHGDHIIVDADKKAGKMKFEVSQRVGEKEPVKTKTK |
Ga0209488_107328552 | 3300027903 | Vadose Zone Soil | DGEILHGDHVVVDADKKAGRMKFEVSKRVGEKEPLKRS |
Ga0209415_109343221 | 3300027905 | Peatlands Soil | MKILDGEVLHGDHVIVDADKRAGKMKFEISKRVGEEEPVKAKR |
Ga0209415_111310871 | 3300027905 | Peatlands Soil | LDGEVLHGDHVVVDADKKAGKMTFAVSKRVGEKEPAKARK |
Ga0209698_105669172 | 3300027911 | Watersheds | EVLHGDHVVVDADKRAGKMTFAVSKRVGEKESAKAKR |
Ga0137415_108486791 | 3300028536 | Vadose Zone Soil | EVLHGDHVVVDADGKTGKMTFKVSERVGEKVAARAKK |
Ga0265326_101038211 | 3300028558 | Rhizosphere | KILDGAVLHGDHVIVDADKKAGKMTFTVGERAGGKEQTRATQ |
Ga0302269_11078401 | 3300028766 | Bog | GAILHGDHIIVDADKKAGKMKFEVSKRVGEKEPAKAKR |
Ga0302222_104389212 | 3300028798 | Palsa | EILHGDHIVVDADSKLGKMTFAVSKRVGEKEPAKAKR |
Ga0308309_107930583 | 3300028906 | Soil | LDGEILHGDHIVVDADKKTGKMKFEVSKRVGEPEAAKAKR |
Ga0311358_111492351 | 3300029915 | Bog | LDGEILHGDHIVVDADKKTGKMKFEISKRVGEKETAKAKR |
Ga0311330_107719361 | 3300029945 | Bog | DGEILHGDHIVVDADKKAGKMKFEVSRRVGEKERVKAK |
Ga0311371_102763802 | 3300029951 | Palsa | LDGEILHGDHVVVDADKKAGKMKIEVSKRVGEKEPVKAKR |
Ga0311346_114268162 | 3300029952 | Bog | LHGDHVIVDADKKAGKMTFKVSERVRDKVAGQAKK |
Ga0311343_107057141 | 3300029953 | Bog | LDGEILHGDHVVIDADKKSGKMKVEVSKRVGEKEPAKAKR |
Ga0302172_100423851 | 3300030003 | Fen | LKILDSEVLHGDHVIVDGAQGKLTFRVSERVGEATAAKK |
Ga0311338_103365053 | 3300030007 | Palsa | ILHGDHIVVDADSKLGKMTFAVSKRVGEKEPAKAKR |
Ga0311338_111504661 | 3300030007 | Palsa | LDGDVLPGDHVVVDSDRKTGKLQFEVSKRVGAKEPAKVKR |
Ga0302306_104130832 | 3300030043 | Palsa | GEVLHGDHIVVDADKKLGKLKFEVSKRVGEKEPAKTKTK |
Ga0302182_101607241 | 3300030054 | Palsa | LRILDGEILHGDHIVVDVDKKAGKMKFEVSHRVGVKAPAKERRGNALR |
Ga0302179_101744683 | 3300030058 | Palsa | LHGDHIVVDADKKLGKMKFEVSKRVGEKEPAKAKTK |
Ga0302192_102895622 | 3300030507 | Bog | KILDGAILHGDHIIVDADKKAGKMKFEVSKRVGEKEPAKAKR |
Ga0265460_110955081 | 3300030740 | Soil | EVLHGDHIVVDADKKLGKMKFEVSKRVGEKEPAKAKTK |
Ga0265762_10356641 | 3300030760 | Soil | VLHGDHVVVDADKKAGKLTFKVSERVGKKEASAKGTARKG |
Ga0265762_11303891 | 3300030760 | Soil | EILHGDHVVVDADKKAGKMKFEVSKRVGEKEPVKAKR |
Ga0170824_1161024682 | 3300031231 | Forest Soil | LHGDHVIVDADKKTGKMRFEVSKRVGEKEPVKAKR |
Ga0302323_1017150591 | 3300031232 | Fen | GEVLHGDHVMVDADKKAGKMTFKVSGRVGEKVTGAKK |
Ga0302324_1030141021 | 3300031236 | Palsa | GDHIVVDADKKAGKLTFKVSERVGKKEASVKESTRKG |
Ga0302326_102394885 | 3300031525 | Palsa | LDGEVLHGDHVVVDADKKAGKMTFKVSERVGAKEPARAKK |
Ga0302326_114875621 | 3300031525 | Palsa | GEILHGDHIVLDADKKAGKMKFEISKRVGASVPAPAVKKASK |
Ga0307476_102204611 | 3300031715 | Hardwood Forest Soil | GEVLHGDHVIVDADKKAGKMRFEVSKRVGEKEPAKAKR |
Ga0310813_105172602 | 3300031716 | Soil | VLHGDHMIADAEKKSGKIAFKVSHRVGEKEPAKTT |
Ga0307474_108467942 | 3300031718 | Hardwood Forest Soil | LHGDHVIVDADKRAGKMKFEVSKRVGEQEPAKTRR |
Ga0307468_1000915103 | 3300031740 | Hardwood Forest Soil | SEILHGDHVIVDADKRTGKIIIEVSKRVGEREPAKLKRA |
Ga0306926_102318441 | 3300031954 | Soil | VLHGDHVIVDADKKAGALKFKVAQRVGSAEPATVPGH |
Ga0307479_105102831 | 3300031962 | Hardwood Forest Soil | ILDGEILHGDHVIVDADKKAGKMKFEVSKRVGEKEAAKARR |
Ga0318525_103915801 | 3300032089 | Soil | VLHGDHVIVDADLKSGKLAFRVSARVGQRGTAKARE |
Ga0307471_1000442691 | 3300032180 | Hardwood Forest Soil | ILDGEVLHGDHVIVDADKRSGKLTFKVSERVGEKGPVRAKR |
Ga0307471_1016047361 | 3300032180 | Hardwood Forest Soil | ILHGDHVVVEADKKAGKMTFEVSKRVGEKEPAKVRR |
Ga0307472_1001318783 | 3300032205 | Hardwood Forest Soil | AGEVPHGDHVVVDADKRAGKMKFEVSKRVGEKEPAKVKKAG |
Ga0335085_113260602 | 3300032770 | Soil | DGEVLHGDHVVVDADKKTGKMTFEVSKRVGEKEATRPRR |
Ga0335078_124735121 | 3300032805 | Soil | LHGDHVIVDADMRAGTMKFEVSRHAPAKEPAKARR |
Ga0335080_123335381 | 3300032828 | Soil | EVLHGDHVVVDTDKKSGALTFKVSKRVGEKEPVGGKK |
Ga0335081_103505183 | 3300032892 | Soil | LHGDHVVVDADKRAGKMKFEVSKRVGEKQAAKARR |
Ga0335081_117592361 | 3300032892 | Soil | ILDGEVLHGDHVVVDADKKAGKMKFEVSKRVGEKQAAKARR |
Ga0335084_116572471 | 3300033004 | Soil | ILDGEVLHGDHVIVDADKRASKMTFQVSKRVNAKEVAQVTR |
Ga0335077_111986852 | 3300033158 | Soil | LHGDHVVVDADKRAGKMVFEVSKRVGEKEPAKAKR |
Ga0335077_117123122 | 3300033158 | Soil | VLHGDHVVVDADVKARKMTFKVSERVGEKKPAGARK |
Ga0334790_221743_1_117 | 3300033887 | Soil | LDGEILHGDHIIIEADKKAGKMKFEVSKRVGEPAKAKR |
Ga0371488_0068304_2_121 | 3300033983 | Peat Soil | DGEILHGDHIVVDADKKAGKMKFEVSQRVGEKEPAKAKR |
Ga0370515_0041636_1937_2047 | 3300034163 | Untreated Peat Soil | VLHGDHIVVDADKKAGKMRLAVSKRVGEKDPAGTQK |
⦗Top⦘ |