NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012262

Metagenome / Metatranscriptome Family F012262

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012262
Family Type Metagenome / Metatranscriptome
Number of Sequences 282
Average Sequence Length 39 residues
Representative Sequence TTEHVVKNYLRLIYDKLGLWNRVELALWYEARRHEQVYHA
Number of Associated Samples 228
Number of Associated Scaffolds 282

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.83 %
% of genes near scaffold ends (potentially truncated) 87.59 %
% of genes from short scaffolds (< 2000 bps) 80.50 %
Associated GOLD sequencing projects 218
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.227 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(12.411 % of family members)
Environment Ontology (ENVO) Unclassified
(24.823 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.163 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.88%    β-sheet: 0.00%    Coil/Unstructured: 44.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 282 Family Scaffolds
PF00196GerE 7.80
PF13185GAF_2 3.19
PF08238Sel1 2.48
PF00873ACR_tran 2.13
PF11741AMIN 1.42
PF14384BrnA_antitoxin 1.42
PF07969Amidohydro_3 1.42
PF14078DUF4259 1.42
PF04851ResIII 0.71
PF00034Cytochrom_C 0.71
PF00571CBS 0.71
PF03069FmdA_AmdA 0.71
PF07676PD40 0.71
PF13380CoA_binding_2 0.71
PF02518HATPase_c 0.71
PF13188PAS_8 0.71
PF04185Phosphoesterase 0.71
PF00072Response_reg 0.35
PF13470PIN_3 0.35
PF00582Usp 0.35
PF03551PadR 0.35
PF13462Thioredoxin_4 0.35
PF13248zf-ribbon_3 0.35
PF00903Glyoxalase 0.35
PF10101DUF2339 0.35
PF01402RHH_1 0.35
PF13620CarboxypepD_reg 0.35
PF00230MIP 0.35
PF02954HTH_8 0.35
PF06537DHOR 0.35
PF04389Peptidase_M28 0.35
PF00005ABC_tran 0.35
PF09699Paired_CXXCH_1 0.35
PF03169OPT 0.35
PF01833TIG 0.35
PF05935Arylsulfotrans 0.35
PF02321OEP 0.35
PF00082Peptidase_S8 0.35
PF13469Sulfotransfer_3 0.35
PF12762DDE_Tnp_IS1595 0.35
PF06172Cupin_5 0.35
PF14791DNA_pol_B_thumb 0.35
PF13676TIR_2 0.35
PF04073tRNA_edit 0.35
PF12019GspH 0.35
PF01380SIS 0.35

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 282 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 0.71
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.71
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.71
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.35
COG1297Predicted oligopeptide transporter, OPT familyGeneral function prediction only [R] 0.35
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.35
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.35
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.35
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.35
COG3542Predicted sugar epimerase, cupin superfamilyGeneral function prediction only [R] 0.35


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.23 %
UnclassifiedrootN/A1.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908038|B3_all_c_ConsensusfromContig168534All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300001686|C688J18823_11009606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis528Open in IMG/M
3300003324|soilH2_10302737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1468Open in IMG/M
3300004092|Ga0062389_103325327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae602Open in IMG/M
3300004635|Ga0062388_102818699All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005167|Ga0066672_10128364All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1574Open in IMG/M
3300005167|Ga0066672_10901412All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300005181|Ga0066678_10959357All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300005332|Ga0066388_106535867All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300005435|Ga0070714_101400931All Organisms → cellular organisms → Bacteria → Acidobacteria683Open in IMG/M
3300005435|Ga0070714_101539400All Organisms → cellular organisms → Bacteria → Acidobacteria650Open in IMG/M
3300005436|Ga0070713_100783356All Organisms → cellular organisms → Bacteria914Open in IMG/M
3300005533|Ga0070734_10647842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7601Open in IMG/M
3300005534|Ga0070735_10178984All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1305Open in IMG/M
3300005539|Ga0068853_100159381All Organisms → cellular organisms → Bacteria2035Open in IMG/M
3300005542|Ga0070732_10097862All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1727Open in IMG/M
3300005563|Ga0068855_100977559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae890Open in IMG/M
3300005586|Ga0066691_10528834All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae704Open in IMG/M
3300005587|Ga0066654_10910800All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005591|Ga0070761_10511484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae741Open in IMG/M
3300005602|Ga0070762_10028022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2991Open in IMG/M
3300005610|Ga0070763_10562352All Organisms → cellular organisms → Bacteria658Open in IMG/M
3300005712|Ga0070764_10010359All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4523Open in IMG/M
3300005712|Ga0070764_10544896All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300005712|Ga0070764_10587360All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005764|Ga0066903_104010800All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae789Open in IMG/M
3300005995|Ga0066790_10058699All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300006028|Ga0070717_10632383All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300006028|Ga0070717_11083213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium730Open in IMG/M
3300006028|Ga0070717_12137378All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006046|Ga0066652_100481674All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300006052|Ga0075029_100676773All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300006052|Ga0075029_100818543All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300006059|Ga0075017_100619241All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300006173|Ga0070716_100240054All Organisms → cellular organisms → Bacteria1228Open in IMG/M
3300006174|Ga0075014_100097060All Organisms → cellular organisms → Bacteria1367Open in IMG/M
3300006176|Ga0070765_102228859All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300006893|Ga0073928_10624136All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300009089|Ga0099828_11290512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300009093|Ga0105240_11042657All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300009137|Ga0066709_103532808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium567Open in IMG/M
3300009148|Ga0105243_10193713All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300009148|Ga0105243_10878626All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300009519|Ga0116108_1015378All Organisms → cellular organisms → Bacteria2727Open in IMG/M
3300009519|Ga0116108_1075506All Organisms → cellular organisms → Bacteria1039Open in IMG/M
3300009519|Ga0116108_1147738All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300009520|Ga0116214_1117240All Organisms → cellular organisms → Bacteria983Open in IMG/M
3300009521|Ga0116222_1055465All Organisms → cellular organisms → Bacteria1722Open in IMG/M
3300009522|Ga0116218_1168472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria993Open in IMG/M
3300009545|Ga0105237_10916844All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium883Open in IMG/M
3300009547|Ga0116136_1011809All Organisms → cellular organisms → Bacteria → Acidobacteria3148Open in IMG/M
3300009548|Ga0116107_1197757All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300009617|Ga0116123_1142768All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300009623|Ga0116133_1003055All Organisms → cellular organisms → Bacteria4418Open in IMG/M
3300009623|Ga0116133_1123587All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300009628|Ga0116125_1007616All Organisms → cellular organisms → Bacteria2943Open in IMG/M
3300009629|Ga0116119_1014425All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300009700|Ga0116217_10062566All Organisms → cellular organisms → Bacteria2643Open in IMG/M
3300009762|Ga0116130_1039454All Organisms → cellular organisms → Bacteria1513Open in IMG/M
3300009764|Ga0116134_1120871All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300009792|Ga0126374_11001397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium655Open in IMG/M
3300010049|Ga0123356_11078702All Organisms → cellular organisms → Bacteria → Acidobacteria972Open in IMG/M
3300010049|Ga0123356_11660969All Organisms → cellular organisms → Bacteria → Acidobacteria792Open in IMG/M
3300010325|Ga0134064_10452167All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300010335|Ga0134063_10719030All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300010339|Ga0074046_10002962All Organisms → cellular organisms → Bacteria → Acidobacteria14418Open in IMG/M
3300010339|Ga0074046_10026230All Organisms → cellular organisms → Bacteria → Acidobacteria4011Open in IMG/M
3300010339|Ga0074046_10038216All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300010343|Ga0074044_10021210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium4690Open in IMG/M
3300010343|Ga0074044_10028039All Organisms → cellular organisms → Bacteria → Acidobacteria3993Open in IMG/M
3300010358|Ga0126370_11340728All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium673Open in IMG/M
3300010361|Ga0126378_12644439All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300010371|Ga0134125_10177542All Organisms → cellular organisms → Bacteria → Acidobacteria2372Open in IMG/M
3300010371|Ga0134125_10336817All Organisms → cellular organisms → Bacteria → Acidobacteria1674Open in IMG/M
3300010373|Ga0134128_10963139All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300010373|Ga0134128_10994705All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium927Open in IMG/M
3300010375|Ga0105239_11183257All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300010375|Ga0105239_11244047All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300010376|Ga0126381_101131786All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300010376|Ga0126381_104347558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300010397|Ga0134124_10338064All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1415Open in IMG/M
3300010399|Ga0134127_11428399All Organisms → cellular organisms → Bacteria → Acidobacteria763Open in IMG/M
3300010403|Ga0134123_10173689All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1808Open in IMG/M
3300010860|Ga0126351_1166742All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300011052|Ga0138585_104056All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300011054|Ga0138523_1089235All Organisms → cellular organisms → Bacteria → Acidobacteria785Open in IMG/M
3300011060|Ga0138583_1078457All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300011063|Ga0138537_1051933All Organisms → cellular organisms → Bacteria → Acidobacteria506Open in IMG/M
3300011085|Ga0138581_1004083All Organisms → cellular organisms → Bacteria → Acidobacteria546Open in IMG/M
3300011120|Ga0150983_15239427All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300011269|Ga0137392_10359699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1206Open in IMG/M
3300011270|Ga0137391_10108621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2405Open in IMG/M
3300011271|Ga0137393_10599012All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium945Open in IMG/M
3300012096|Ga0137389_10086742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2459Open in IMG/M
3300012189|Ga0137388_10036211All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3894Open in IMG/M
3300012189|Ga0137388_10553112All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300012199|Ga0137383_10077608All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2398Open in IMG/M
3300012200|Ga0137382_10070937All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2232Open in IMG/M
3300012203|Ga0137399_10138810All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300012203|Ga0137399_10493294All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300012203|Ga0137399_11121191All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300012205|Ga0137362_10939698All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium738Open in IMG/M
3300012208|Ga0137376_11363940All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300012211|Ga0137377_10398789All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1314Open in IMG/M
3300012351|Ga0137386_10225084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1348Open in IMG/M
3300012357|Ga0137384_11254104All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium587Open in IMG/M
3300012361|Ga0137360_10898742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium763Open in IMG/M
3300012361|Ga0137360_10908281All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300012362|Ga0137361_11012693All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300012683|Ga0137398_11117375All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012930|Ga0137407_11200754All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300012930|Ga0137407_11456462All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium651Open in IMG/M
3300012944|Ga0137410_10111347All Organisms → cellular organisms → Bacteria2043Open in IMG/M
3300012948|Ga0126375_11162869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium640Open in IMG/M
3300012957|Ga0164303_10759522All Organisms → cellular organisms → Bacteria661Open in IMG/M
3300012960|Ga0164301_10230274All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300012986|Ga0164304_10348116All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1034Open in IMG/M
3300012987|Ga0164307_10441866All Organisms → cellular organisms → Bacteria969Open in IMG/M
3300013102|Ga0157371_10649234All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300014156|Ga0181518_10062492All Organisms → cellular organisms → Bacteria2179Open in IMG/M
3300014158|Ga0181521_10178352All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1187Open in IMG/M
3300014167|Ga0181528_10046537All Organisms → cellular organisms → Bacteria2412Open in IMG/M
3300014200|Ga0181526_10026066All Organisms → cellular organisms → Bacteria3809Open in IMG/M
3300014200|Ga0181526_11015341All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300014489|Ga0182018_10181819All Organisms → cellular organisms → Bacteria → Acidobacteria1185Open in IMG/M
3300014490|Ga0182010_10180610All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300014492|Ga0182013_10001103All Organisms → cellular organisms → Bacteria37417Open in IMG/M
3300014492|Ga0182013_10554316All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300014654|Ga0181525_10041865All Organisms → cellular organisms → Bacteria2655Open in IMG/M
3300014654|Ga0181525_10304065All Organisms → cellular organisms → Bacteria → Acidobacteria871Open in IMG/M
3300014657|Ga0181522_10629965All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300014745|Ga0157377_11702972All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300014838|Ga0182030_10001787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae44888Open in IMG/M
3300015082|Ga0167662_1006702All Organisms → cellular organisms → Bacteria1396Open in IMG/M
3300015373|Ga0132257_100455715All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300016294|Ga0182041_11007142All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300017822|Ga0187802_10073421All Organisms → cellular organisms → Bacteria1270Open in IMG/M
3300017822|Ga0187802_10266926All Organisms → cellular organisms → Bacteria → Acidobacteria664Open in IMG/M
3300017823|Ga0187818_10008275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4441Open in IMG/M
3300017925|Ga0187856_1072367All Organisms → cellular organisms → Bacteria1434Open in IMG/M
3300017931|Ga0187877_1003421All Organisms → cellular organisms → Bacteria12936Open in IMG/M
3300017943|Ga0187819_10066018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2151Open in IMG/M
3300017966|Ga0187776_11506114All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300017975|Ga0187782_10012810All Organisms → cellular organisms → Bacteria6144Open in IMG/M
3300017975|Ga0187782_11635232All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300017994|Ga0187822_10097921All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium891Open in IMG/M
3300017995|Ga0187816_10175278All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300017995|Ga0187816_10404149All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300017995|Ga0187816_10539057All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018002|Ga0187868_1245434All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300018006|Ga0187804_10077913All Organisms → cellular organisms → Bacteria1337Open in IMG/M
3300018021|Ga0187882_1264496All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae663Open in IMG/M
3300018023|Ga0187889_10030685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA23060Open in IMG/M
3300018023|Ga0187889_10483975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Eggerthellales → Eggerthellaceae → Adlercreutzia → Adlercreutzia equolifaciens529Open in IMG/M
3300018034|Ga0187863_10536794All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300018038|Ga0187855_10592524All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300018040|Ga0187862_10108817All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21910Open in IMG/M
3300018043|Ga0187887_10744039All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300018057|Ga0187858_10232226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71191Open in IMG/M
3300018057|Ga0187858_10941243All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300018085|Ga0187772_10390404All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300018085|Ga0187772_11076358All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300018089|Ga0187774_10166361All Organisms → cellular organisms → Bacteria1174Open in IMG/M
3300018090|Ga0187770_10666579All Organisms → cellular organisms → Bacteria → Acidobacteria829Open in IMG/M
3300019278|Ga0187800_1700003All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300019284|Ga0187797_1214565All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300019787|Ga0182031_1086056Not Available1093Open in IMG/M
3300020060|Ga0193717_1110593All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300020580|Ga0210403_10552283All Organisms → cellular organisms → Bacteria933Open in IMG/M
3300020581|Ga0210399_11347522All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300020583|Ga0210401_10025745All Organisms → cellular organisms → Bacteria5623Open in IMG/M
3300020583|Ga0210401_10193127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1893Open in IMG/M
3300021088|Ga0210404_10543817All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium658Open in IMG/M
3300021170|Ga0210400_10663180All Organisms → cellular organisms → Bacteria → Acidobacteria859Open in IMG/M
3300021171|Ga0210405_10870206All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium686Open in IMG/M
3300021180|Ga0210396_11021666All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300021181|Ga0210388_10272258All Organisms → cellular organisms → Bacteria → Acidobacteria1486Open in IMG/M
3300021344|Ga0193719_10121032All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1137Open in IMG/M
3300021403|Ga0210397_10179380All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1501Open in IMG/M
3300021404|Ga0210389_10244837All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300021404|Ga0210389_10312420All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300021407|Ga0210383_10628169All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300021420|Ga0210394_10203380All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300021420|Ga0210394_10622164All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300021420|Ga0210394_11591398All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300021477|Ga0210398_10623221All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300021478|Ga0210402_10137677All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP1872218Open in IMG/M
3300021478|Ga0210402_11423721All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium620Open in IMG/M
3300021478|Ga0210402_11576118All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300021478|Ga0210402_11678064All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300021478|Ga0210402_11687591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium560Open in IMG/M
3300021479|Ga0210410_11606491All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300021559|Ga0210409_10814714All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300021861|Ga0213853_10784446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1243Open in IMG/M
3300022532|Ga0242655_10130871All Organisms → cellular organisms → Bacteria → Acidobacteria719Open in IMG/M
3300022557|Ga0212123_10767742All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300023101|Ga0224557_1243212All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300025432|Ga0208821_1008358All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA22696Open in IMG/M
3300025439|Ga0208323_1008915All Organisms → cellular organisms → Bacteria → Acidobacteria2588Open in IMG/M
3300025453|Ga0208455_1002135All Organisms → cellular organisms → Bacteria5897Open in IMG/M
3300025460|Ga0208562_1056173All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium841Open in IMG/M
3300025480|Ga0208688_1079029All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300025900|Ga0207710_10158257All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300025906|Ga0207699_10170112All Organisms → cellular organisms → Bacteria1457Open in IMG/M
3300025915|Ga0207693_10247287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1400Open in IMG/M
3300025916|Ga0207663_10538521All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300025922|Ga0207646_11524981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300025929|Ga0207664_11085699All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium716Open in IMG/M
3300025961|Ga0207712_11934860All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300026089|Ga0207648_10006055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae12060Open in IMG/M
3300026217|Ga0209871_1053838All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300026277|Ga0209350_1043724All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1309Open in IMG/M
3300026291|Ga0209890_10221983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia598Open in IMG/M
3300026298|Ga0209236_1185120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium812Open in IMG/M
3300026309|Ga0209055_1013719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4125Open in IMG/M
3300026324|Ga0209470_1365446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium516Open in IMG/M
3300026497|Ga0257164_1065820All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300026498|Ga0257156_1082869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium666Open in IMG/M
3300026508|Ga0257161_1129111All Organisms → cellular organisms → Bacteria530Open in IMG/M
3300026550|Ga0209474_10271614All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300026551|Ga0209648_10075393All Organisms → cellular organisms → Bacteria → Acidobacteria2829Open in IMG/M
3300027678|Ga0209011_1036044All Organisms → cellular organisms → Bacteria → Acidobacteria1553Open in IMG/M
3300027824|Ga0209040_10461719All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300027826|Ga0209060_10436111All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7595Open in IMG/M
3300027862|Ga0209701_10110398All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1710Open in IMG/M
3300027879|Ga0209169_10417159All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300027884|Ga0209275_10411562All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300027898|Ga0209067_10554063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300027911|Ga0209698_10296666All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300027911|Ga0209698_10317897All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1229Open in IMG/M
3300027911|Ga0209698_10319327All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1226Open in IMG/M
3300028016|Ga0265354_1001739All Organisms → cellular organisms → Bacteria2995Open in IMG/M
3300028023|Ga0265357_1022173All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300028090|Ga0255349_1036342Not Available1066Open in IMG/M
3300028828|Ga0307312_10907310All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300028906|Ga0308309_11040802All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium708Open in IMG/M
3300029903|Ga0247271_102366All Organisms → cellular organisms → Bacteria → Acidobacteria4246Open in IMG/M
3300030494|Ga0310037_10039343All Organisms → cellular organisms → Bacteria2263Open in IMG/M
3300030494|Ga0310037_10090500All Organisms → cellular organisms → Bacteria1425Open in IMG/M
3300030581|Ga0210270_1861355All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300030687|Ga0302309_10238498All Organisms → cellular organisms → Bacteria → Acidobacteria920Open in IMG/M
3300030688|Ga0311345_10560774All Organisms → cellular organisms → Bacteria961Open in IMG/M
3300030741|Ga0265459_13957264All Organisms → cellular organisms → Bacteria → Acidobacteria520Open in IMG/M
3300030962|Ga0138297_1554998All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300031231|Ga0170824_112217076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium675Open in IMG/M
3300031244|Ga0302297_1046836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300031247|Ga0265340_10113182All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300031344|Ga0265316_10062152All Organisms → cellular organisms → Bacteria → Acidobacteria2899Open in IMG/M
3300031708|Ga0310686_117395533All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300031708|Ga0310686_117448622All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1095Open in IMG/M
3300031715|Ga0307476_10999351All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031718|Ga0307474_10439450All Organisms → cellular organisms → Bacteria → Acidobacteria1019Open in IMG/M
3300031720|Ga0307469_11684463All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300031754|Ga0307475_10331939All Organisms → cellular organisms → Bacteria → Acidobacteria1221Open in IMG/M
3300031823|Ga0307478_10407755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1126Open in IMG/M
3300031823|Ga0307478_10871625All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300031946|Ga0310910_10581075All Organisms → cellular organisms → Bacteria888Open in IMG/M
3300031962|Ga0307479_12113669All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300032067|Ga0318524_10477610All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300032160|Ga0311301_11647212All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300032205|Ga0307472_102186818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300032261|Ga0306920_100407477All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2022Open in IMG/M
3300032421|Ga0310812_10013648All Organisms → cellular organisms → Bacteria → Acidobacteria2754Open in IMG/M
3300032515|Ga0348332_13109510All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300032782|Ga0335082_10109901All Organisms → cellular organisms → Bacteria → Acidobacteria2719Open in IMG/M
3300032805|Ga0335078_10853944All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300033004|Ga0335084_11250781All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300033134|Ga0335073_10055168All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA75290Open in IMG/M
3300033134|Ga0335073_10419660All Organisms → cellular organisms → Bacteria1557Open in IMG/M
3300033158|Ga0335077_10894215All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300033158|Ga0335077_11204447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae741Open in IMG/M
3300033822|Ga0334828_000355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae24812Open in IMG/M
3300033822|Ga0334828_079618All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300033823|Ga0334837_009550All Organisms → cellular organisms → Bacteria4502Open in IMG/M
3300033982|Ga0371487_0001640All Organisms → cellular organisms → Bacteria27702Open in IMG/M
3300033983|Ga0371488_0017823All Organisms → cellular organisms → Bacteria5348Open in IMG/M
3300033983|Ga0371488_0297598All Organisms → cellular organisms → Bacteria → Acidobacteria773Open in IMG/M
3300033983|Ga0371488_0413495All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300034124|Ga0370483_0160725All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.41%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.87%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.03%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.26%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.55%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.55%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.19%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.19%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.84%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.84%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.84%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.48%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.48%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.13%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.42%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.42%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog1.42%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.42%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.42%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere1.42%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.77%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.77%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.06%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.06%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.71%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.71%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.71%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.71%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.35%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.35%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.35%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.35%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.35%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.35%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.35%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.35%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.35%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.35%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.35%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.35%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.35%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.35%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.35%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.35%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.35%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005534Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010049Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3Host-AssociatedOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010860Boreal forest soil eukaryotic communities from Alaska, USA - C5-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011052Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 75 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011054Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 1 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011060Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 73 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011063Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011085Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014492Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015082Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019787Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025460Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026217Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300026508Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-AEnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028016Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1Host-AssociatedOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028090Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25.v15EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029903Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703EnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030581Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO142-VCO031SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030687Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_1EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030962Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A4_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031244Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2EnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033823Peat soil microbial communities from Stordalen Mire, Sweden - 714 S3 30-34EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B3_all_c_018056702124908038SoilDSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
C688J18823_1100960623300001686SoilIGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARREEIPA*
soilH2_1030273713300003324Sugarcane Root And Bulk SoilTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLLMAQAQ*
Ga0062389_10332532713300004092Bog Forest SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRQEPQLPA*
Ga0062388_10281869923300004635Bog Forest SoilEVAQTIGTTPHVVKNYLRTIYDQLGLWNRVELALWYEARKQERHDHN*
Ga0066672_1012836423300005167SoilYLRVIYDKLGLWNRVELALWYEARQHEKTFNACDGSLGT*
Ga0066672_1090141213300005167SoilTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLLLAHTH*
Ga0066678_1095935713300005181SoilGTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHENLVPQVH*
Ga0066388_10653586713300005332Tropical Forest SoilEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLATAQIH*
Ga0070714_10140093113300005435Agricultural SoilGTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRFEGMFLAAAN*
Ga0070714_10153940013300005435Agricultural SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRFEGMFLSPAH*
Ga0070713_10078335613300005436Corn, Switchgrass And Miscanthus RhizosphereSEHVVKNYLRTIYDKLGLWNRVELALWYEARRHEGLALAQSH*
Ga0070734_1064784223300005533Surface SoilAVKNYVHAIYDKLGLWNRVELALWYEARKHERLIGAGIV*
Ga0070735_1017898413300005534Surface SoilEAIGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARRHESLVHA*
Ga0068853_10015938133300005539Corn RhizosphereGTTEHVIKNYLRSIYDKLGLWNRVELALWYEARRFETTGQA*
Ga0070732_1009786213300005542Surface SoilNYLRTIYDKLGLWNRVELALWYEARRHEGLVLAQSL*
Ga0068855_10097755923300005563Corn RhizosphereTEYVIKNYLRIIYDKLGVWNRTELALWYEANRTNNQ*
Ga0066691_1052883423300005586SoilTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQLFHA*
Ga0066654_1091080023300005587SoilHVIKNYLRVIYDKLGLWNRVELALWYEARQHEQAYQA*
Ga0070761_1051148433300005591SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRQEPHLQA*
Ga0070762_1002802233300005602SoilAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHENLVQA*
Ga0070763_1056235223300005610SoilVKNYLRNIYDKLGLWNRVELALWYEARRYEDIARA*
Ga0070764_1001035913300005712SoilHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYQA*
Ga0070764_1054489623300005712SoilHVVKNYLRVIYDKLGLWNRVELALWYEARRHDGPVGA*
Ga0070764_1058736013300005712SoilAEAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVQA*
Ga0066903_10401080013300005764Tropical Forest SoilTTEHVVKNYLRTIYDKLGLWNRVELALWYEARREEIAA*
Ga0066790_1005869933300005995SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEAAAQA*
Ga0070717_1063238323300006028Corn, Switchgrass And Miscanthus RhizosphereADAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRPESPSQA*
Ga0070717_1108321323300006028Corn, Switchgrass And Miscanthus RhizosphereYLRTIYDKLGLWNRVELALWYEARRHESLVAIHAH*
Ga0070717_1213737813300006028Corn, Switchgrass And Miscanthus RhizosphereDAIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQEGVAHA*
Ga0066652_10048167423300006046SoilTEHVVKNYLRIIYDKLGLWNRVELALWYEARKQESLAHA*
Ga0075029_10067677323300006052WatershedsADAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRTESVFLTQ*
Ga0075029_10081854313300006052WatershedsLGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEQPYQA*
Ga0075017_10061924123300006059WatershedsTEHVVKNYLRVIYDKLGLWNRVELALWYESRRTESVFLTQ*
Ga0070716_10024005423300006173Corn, Switchgrass And Miscanthus RhizosphereVKNYLRVIYDKLGLWNRVELALWYEARKYEQIARA*
Ga0075014_10009706033300006174WatershedsLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRDEQVYHA*
Ga0070765_10222885923300006176SoilTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVQA*
Ga0073928_1062413613300006893Iron-Sulfur Acid SpringIGTTEHVVKNYLRAIYDKLGLWNRVELALWHEARQHESLLAGA*
Ga0099828_1129051213300009089Vadose Zone SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGMLLAQTN*
Ga0105240_1104265713300009093Corn RhizosphereGTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLVMAQAN*
Ga0066709_10353280813300009137Grasslands SoilEHVIKNYLRTIYDKLGLWNRVELALWYEARRHESLVPQVH*
Ga0105243_1019371333300009148Miscanthus RhizosphereTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA*
Ga0105243_1087862623300009148Miscanthus RhizosphereGTTEHVIKNYLRVIYDKLGLWNRVELALWYEARRHEEPVHA*
Ga0116108_101537823300009519PeatlandVVKNYLRLIYDKLGLWNRVELALWYEARRHEQVYHA*
Ga0116108_107550613300009519PeatlandDSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEHIYHA*
Ga0116108_114773813300009519PeatlandLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA*
Ga0116214_111724023300009520Peatlands SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQMYHA*
Ga0116222_105546533300009521Peatlands SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQIYHA*
Ga0116218_116847223300009522Peatlands SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA*
Ga0105237_1091684413300009545Corn RhizosphereHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLVMAQAN*
Ga0116136_101180913300009547PeatlandEHVVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA*
Ga0116107_119775713300009548PeatlandGTTEHVVKNYLRLIYDRLGLWNRVELALWYEARRHERVYHA*
Ga0116123_114276813300009617PeatlandHVVKNYLRLIYDKLGLWNRVELALWYEARQDEQLYHA*
Ga0116133_100305533300009623PeatlandVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA*
Ga0116133_112358723300009623PeatlandNYLRVIYDKLGLWNRVELALWYEARKFEHAMNAYAVNA*
Ga0116125_100761653300009628PeatlandVVKNYLRLIYDKLGMWNRVELALWYVARQDEQVYNA*
Ga0116119_101442523300009629PeatlandVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA*
Ga0116217_1006256633300009700Peatlands SoilTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEALAQA*
Ga0116130_103945423300009762PeatlandMVKNYLRLIYDKLGLWNRVELALWYEARQHEQAYSN*
Ga0116134_112087133300009764PeatlandVVKNYLRVIYDKLGLWNRVELALWYEARRDEQVYHA
Ga0126374_1100139713300009792Tropical Forest SoilHVVKNYLRVIYDKLGLWNRVELALWYEARRFEHVARA*
Ga0123356_1107870213300010049Termite GutNYLRTIYDKLGLWNRVELALWYEARRFEEMNLAAAN*
Ga0123356_1166096913300010049Termite GutHVVKNYLRTIYDKLGLWNRVELALWYEARRFEEMTLAAAN*
Ga0134064_1045216713300010325Grasslands SoilKNYLRIIYDKLGLWNRVELALWYEARRHESLAHA*
Ga0134063_1071903013300010335Grasslands SoilIKNYLRTIYDKLGLWNRVELALWYEARRHENLVPQVH*
Ga0074046_10002962123300010339Bog Forest SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQLYQA*
Ga0074046_1002623033300010339Bog Forest SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQLYHA*
Ga0074046_1003821633300010339Bog Forest SoilVVKNYLRLIYDKLGLWNRVELALWYEARRHEHLYHA*
Ga0074044_1002121013300010343Bog Forest SoilDSIGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNN*
Ga0074044_1002803913300010343Bog Forest SoilDSIGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA*
Ga0126370_1134072823300010358Tropical Forest SoilYLRTIYDKLGLWNRVELALWYEARRHEGLLFAQTT*
Ga0126378_1264443913300010361Tropical Forest SoilAEAIGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRHERHTDA*
Ga0134125_1017754213300010371Terrestrial SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN*
Ga0134125_1033681713300010371Terrestrial SoilIKNYLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN*
Ga0134128_1096313913300010373Terrestrial SoilLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN*
Ga0134128_1099470523300010373Terrestrial SoilIKNYLRTIYDKLGLWNRVELALWYEARRHEGSLVPLMQ*
Ga0105239_1118325723300010375Corn RhizosphereAIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA*
Ga0105239_1124404713300010375Corn RhizosphereHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA*
Ga0126381_10113178613300010376Tropical Forest SoilKNYLRLIYDKLGLWNRVELALWYEARRHERHTDA*
Ga0126381_10434755823300010376Tropical Forest SoilVVKNYLRTIYDKLGLWNRVELALWYEARREEIAA*
Ga0134124_1033806423300010397Terrestrial SoilKNYLRTIYDKLGLWNRVELALWYEARRHEGLVMAQVH*
Ga0134127_1142839913300010399Terrestrial SoilYLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN*
Ga0134123_1017368913300010403Terrestrial SoilLRTIYDKLGLWNRVELALWYEARRHEGLVMAQVH*
Ga0126351_116674213300010860Boreal Forest SoilVVKNYLRLIYDKLGLWNRVELALWYVARQHEGLVHA*
Ga0138585_10405623300011052Peatlands SoilVKNYLRLIYDKLGLWNRVELALWYEARQHEHVYNN*
Ga0138523_108923523300011054Peatlands SoilVVKNYLRLIYDRLGLWNRVELALWYEARQHEQLYHA*
Ga0138583_107845723300011060Peatlands SoilVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA*
Ga0138537_105193323300011063Peatlands SoilVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0138581_100408323300011085Peatlands SoilVKNYLHLIYDKLGLWNRVELALWYEARQHEQVYNA*
Ga0150983_1523942713300011120Forest SoilEAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVGV*
Ga0137392_1035969913300011269Vadose Zone SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLVLAQSH*
Ga0137391_1010862113300011270Vadose Zone SoilYLRTIYDKLGLWNRVELALWYEARRHEGLVLAQSH*
Ga0137393_1059901223300011271Vadose Zone SoilKNYLRTIYDKLGLWNRVELALWYEARRHEGLVLAQSH*
Ga0137389_1008674213300012096Vadose Zone SoilIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRHESLAHA*
Ga0137388_1003621133300012189Vadose Zone SoilQMAVVMGTSQHVIKNNLRSIYDKLGLWNRLELALWYEAHRHQELVS*
Ga0137388_1055311213300012189Vadose Zone SoilTTEHVVKNYLRVIYDKLGLWNRVELALWYEARKHENPARA*
Ga0137383_1007760833300012199Vadose Zone SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLLLAHTH*
Ga0137382_1007093733300012200Vadose Zone SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARKYEQVARA*
Ga0137399_1013881033300012203Vadose Zone SoilVKNYLRLIYDKLGLWNRVELALWYEARQHEQAYSA*
Ga0137399_1049329413300012203Vadose Zone SoilTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRQEPELPA*
Ga0137399_1112119113300012203Vadose Zone SoilTEHVIKNYLRVIYDKLGLWNRVELALWYEARQHEQAYQA*
Ga0137362_1093969823300012205Vadose Zone SoilHVVKNYLRIIYDKLGLWNRVELALWYEARRHESLAHA*
Ga0137376_1136394013300012208Vadose Zone SoilTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQEVPAHA*
Ga0137377_1039878923300012211Vadose Zone SoilTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLLLAQSH*
Ga0137386_1022508413300012351Vadose Zone SoilTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGMLLAQTN*
Ga0137384_1125410423300012357Vadose Zone SoilKNYLRTIYDKLGLWNRVELALWYEARKNEQTLHAGCA*
Ga0137360_1089874223300012361Vadose Zone SoilVVKNYLRIIYDKLGLWNRVELALWYEARRHESLAHA*
Ga0137360_1090828123300012361Vadose Zone SoilTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQIPAHA*
Ga0137361_1101269313300012362Vadose Zone SoilKNYLRIIYDKLGLWNRVELALWYEARRQQIPAHA*
Ga0137398_1111737513300012683Vadose Zone SoilKNYLRIIYDKLGLWNRVELALWYEARQDERAYQA*
Ga0137407_1120075423300012930Vadose Zone SoilGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARKQERHAHA*
Ga0137407_1145646223300012930Vadose Zone SoilVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA*
Ga0137410_1011134713300012944Vadose Zone SoilAIGTTEHVVKKYLRIIYDKLGLWNRVELALWYEARRQEVPAHA*
Ga0126375_1116286923300012948Tropical Forest SoilVVKNYLRVIYDKLGLWNRVELALWYEARRHEHRASA*
Ga0164303_1075952213300012957SoilEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLVMAQAH*
Ga0164301_1023027423300012960SoilVKNYLRTIYDKLGLWNRVELALWYEARRHEGLALAQSH*
Ga0164304_1034811613300012986SoilNYLRTIYDKLGLWNRVELALWYEARRHEQLVQVN*
Ga0164307_1044186613300012987SoilVADAIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA*
Ga0157371_1064923413300013102Corn RhizosphereIGTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGFLMAQVH*
Ga0181518_1006249223300014156BogVKNYLRLIYDKLGLWNRVELALWYEARQHELVYHA*
Ga0181521_1017835223300014158BogMGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEQVYHA*
Ga0181528_1004653733300014167BogVKNYLRLIYDKLGLWNRVELALWYEARQHEQVHA*
Ga0181526_1002606653300014200BogVKNYLRLIYDKLGLWNRVELALWYEARQNERERVYHA*
Ga0181526_1101534123300014200BogGTTEHVVKNYLRSIYDKLGLWNRVELALWYEARQHERVFQA*
Ga0182018_1018181923300014489PalsaEHVVKNYLRVIYDKLGLWNRVELALWYESRRQGPQLPA*
Ga0182010_1018061033300014490FenMGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHERVYHA*
Ga0182013_10001103243300014492BogVVKNYLRVIYDKLGLWNRVELALWYEARQNEQVYHA*
Ga0182013_1055431613300014492BogTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA*
Ga0181525_1004186533300014654BogVKNDLRLIYDKLGLWNRVELALWYEARRFEQAYSN*
Ga0181525_1030406523300014654BogVKNYLRVIYDKLGLWNRVELALWYESRRDDRQLTA*
Ga0181522_1062996523300014657BogRALGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVHA*
Ga0157377_1170297213300014745Miscanthus RhizosphereTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGLVMAQVH*
Ga0182030_10001787243300014838BogVVKNYLRLIYDKLGLWNRVELALWFEARRFEQVYHA*
Ga0167662_100670213300015082Glacier Forefield SoilEHVINNYLRTIYDKLGLWNRVELALWYEARRHEGLLLQN*
Ga0132257_10045571513300015373Arabidopsis RhizosphereTEHVVKNYLRVIYDKLGLWNRVELALWYEARQFEQAVSF*
Ga0182041_1100714213300016294SoilIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARKYEQTARA
Ga0187802_1007342123300017822Freshwater SedimentLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRHENAQVYQA
Ga0187802_1026692623300017822Freshwater SedimentIGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARRYESLQSSYS
Ga0187818_1000827543300017823Freshwater SedimentEHVVKNYLRVIYDKLGLWNRVELALWYEARQHELVYHT
Ga0187856_107236733300017925PeatlandEHVVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA
Ga0187877_100342113300017931PeatlandVKNYLRLIYDKLGLWNRVELALWYEARQHEHIYHA
Ga0187819_1006601823300017943Freshwater SedimentDSIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARQHELVYHT
Ga0187776_1150611413300017966Tropical PeatlandEHVVKNYLRVIYDKLGVWNRVELALWYEARRPEDAAQA
Ga0187782_1001281073300017975Tropical PeatlandVKNCLRAIYDELGLWNRVELALWYEARQRERVREARADGKVA
Ga0187782_1163523223300017975Tropical PeatlandQAIGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARRF
Ga0187822_1009792113300017994Freshwater SedimentIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRFETVARA
Ga0187816_1017527823300017995Freshwater SedimentIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVGV
Ga0187816_1040414923300017995Freshwater SedimentKNYLRLIYDKLGLWNRVELALWYEARRNENAQVYHA
Ga0187816_1053905713300017995Freshwater SedimentDSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA
Ga0187868_124543423300018002PeatlandGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQV
Ga0187804_1007791313300018006Freshwater SedimentGTTEHVVKNYLRSIYDKLGLWNRVELALWYEARRDENLRKAV
Ga0187882_126449613300018021PeatlandVVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA
Ga0187889_1003068523300018023PeatlandVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA
Ga0187889_1048397513300018023PeatlandTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0187863_1053679423300018034PeatlandAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVQV
Ga0187855_1059252413300018038PeatlandTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRHEQVYHA
Ga0187862_1010881713300018040PeatlandHVVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA
Ga0187887_1074403913300018043PeatlandGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRREEPQLPA
Ga0187858_1023222613300018057PeatlandHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYTN
Ga0187858_1094124313300018057PeatlandTTEHMVKNYLRLIYDKLGLWNRVELALWYEARQHEQAYSN
Ga0187772_1039040423300018085Tropical PeatlandGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRWEQTSHA
Ga0187772_1107635813300018085Tropical PeatlandEHVVKNYLRLIYDKLGLWNRVELALWYEARQHELVYHS
Ga0187774_1016636113300018089Tropical PeatlandEHVIKNYLRVIYDKLGLWNRVELALWYEARRYEQAFPA
Ga0187770_1066657913300018090Tropical PeatlandSAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRNDPQLPA
Ga0187800_170000323300019278PeatlandVKNYLRLIYDKLGLWNRVELALWYEARRWEQVYHA
Ga0187797_121456523300019284PeatlandEHVVKNYLRAIYDKLGLWNRVELALWYEARRHEGLVQA
Ga0182031_108605613300019787BogSTWWHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0193717_111059313300020060SoilADAIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQIPAHA
Ga0210403_1055228313300020580SoilVKNYLRVIYDKLGLWNRVELALWYEARRHESLVRV
Ga0210399_1072792523300020581SoilEVAEAMGTTRYVVVNYLRVIYDKLGVWNRVELALWYESRKHQGEMN
Ga0210399_1134752223300020581SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEPELPV
Ga0210401_1002574513300020583SoilVVKNYLRVIYDKLGLWNRVELALWYESRKHEPGFPT
Ga0210401_1019312713300020583SoilEYVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0210404_1054381723300021088SoilVKNYLRVIYDKLGLWNRVELALWYEARRFEQAARA
Ga0210400_1066318023300021170SoilVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA
Ga0210405_1087020613300021171SoilTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0210396_1102166613300021180SoilTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRRESR
Ga0210388_1027225813300021181SoilTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYQA
Ga0193719_1012103213300021344SoilEHVVKNYLRVIYDKLGLWNRVELALWYEARQHEQAYQA
Ga0210397_1017938033300021403SoilMVIKNYLRVIYDKLRLWNRVELALWYEARRHREVMN
Ga0210389_1024483733300021404SoilVVKNDLRLIYDKLGLWNRVELALWYEARQFEQVYSN
Ga0210389_1031242013300021404SoilTTENNVKNSLRVIYDKLGLWNRVELALWYESRQNQPGPTIN
Ga0210383_1062816923300021407SoilVKNYLRVIYDKLGLWNRVELALWYEARRHESLVGV
Ga0210394_1020338013300021420SoilIIGTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0210394_1062216413300021420SoilTTEHVVKNYLRNIYDKLGLWNRVELALWYEARRYEDIARA
Ga0210394_1159139813300021420SoilEHVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVGV
Ga0210391_1083140613300021433SoilITKQVVKNYLRVIYDKLGFYNRVELALWHESRRLTRPTHSVDGK
Ga0210398_1062322123300021477SoilVIKNKLRAIYDKLGVWNRLELALWYEAHRPQEQLN
Ga0210402_1013767733300021478SoilTEFVVKNYLRAIFDKLGFWNRVELALWYEARRHESQ
Ga0210402_1142372123300021478SoilEIIGTTECVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0210402_1157611813300021478SoilIIGTTEMVIKNYLRVIYDKLRLWNRVELALWYEARRHREVMN
Ga0210402_1167806413300021478SoilRIGTTEHVVKNYLRVIYDKLGFYNRVELALWHESRRVESRQS
Ga0210402_1168759113300021478SoilVVRNYISSIYDKVGVNNRVELALWYEARQIEGRASR
Ga0210410_1160649123300021479SoilIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRKHEPGFPT
Ga0210409_1081471413300021559SoilGTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRRESR
Ga0213853_1078444623300021861WatershedsAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRTESVFLTN
Ga0213853_1150422413300021861WatershedsHVVKNYLRVIYDKLGLWNRVELALWYESRRTESVFLTQ
Ga0242655_1013087113300022532SoilHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA
Ga0212123_1076774223300022557Iron-Sulfur Acid SpringIGTTEHVVKNYLRAIYDKLGLWNRVELALWHEARQHESLLAGA
Ga0224557_124321213300023101SoilGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0208821_100835813300025432PeatlandTTEHVVKNYLRLIYDKLGLWNRVELALWYIARQNEQVYHA
Ga0208323_100891513300025439PeatlandVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
Ga0208455_100213563300025453PeatlandVVKNYLRLIYDKLGLWNRVELALWYEARRHEQVYHA
Ga0208562_105617323300025460PeatlandGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
Ga0208688_107902913300025480PeatlandEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA
Ga0207710_1015825723300025900Switchgrass RhizosphereADAIGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA
Ga0207699_1017011233300025906Corn, Switchgrass And Miscanthus RhizosphereGTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQEIPAHA
Ga0207693_1024728723300025915Corn, Switchgrass And Miscanthus RhizosphereIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARKYEQIARA
Ga0207663_1053852113300025916Corn, Switchgrass And Miscanthus RhizosphereIGTSEHVVKNYLRTIYDKLGLWNRVELALWYEARRHEGLALSH
Ga0207646_1152498113300025922Corn, Switchgrass And Miscanthus RhizosphereEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQIHHA
Ga0207664_1108569913300025929Agricultural SoilEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGMVPAHSN
Ga0207712_1193486023300025961Switchgrass RhizosphereEHVVKNYLRVIYDKLGLWNRVELALWYEARQFEQAVSF
Ga0207648_1000605513300026089Miscanthus RhizosphereTTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQQVPAHA
Ga0209871_105383823300026217Permafrost SoilGTTKNNVKNSLRVIYDKLGLWNRVELALWYESRQNQPGLSIN
Ga0209350_104372413300026277Grasslands SoilEHVVKNYLRIIYDKLGLWNRVELALWYEARRYESLAHA
Ga0209890_1022198323300026291SoilNAIGTTEHVVKNYIRAIYDKLGLWNRVELALWYEARRHESMLHA
Ga0209236_118512013300026298Grasslands SoilTEHVVKNYLRIIYDKLGLWNRVELALWYEARKHQNPART
Ga0209055_101371943300026309SoilEHVVKNYLRVIYDKLGLWNRVELALWYEARKYEQIARA
Ga0209470_136544623300026324SoilEHVVKNYLRIIYDKLGLWNRVELALWYEARRHESLAHA
Ga0257164_106582013300026497SoilVIKNYLRVIYDKLGLWNRVELALWYEARQHEQAYQA
Ga0257156_108286913300026498SoilEHVIKNYLRVIYDKLGLWNRVELALWYEARQHEQAYQA
Ga0257161_112911123300026508SoilVVKNYLRIIYDKLGLWNRVELALWYEARRQEVPAQA
Ga0209474_1027161443300026550SoilTEHVVKNYLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN
Ga0209648_1007539333300026551Grasslands SoilHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGMLLAQTN
Ga0209011_103604413300027678Forest SoilSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYHA
Ga0209040_1046171923300027824Bog Forest SoilAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRRGPLAQA
Ga0209060_1043611123300027826Surface SoilAVKNYVHAIYDKLGLWNRVELALWYEARKHERLIGAGIV
Ga0209701_1011039813300027862Vadose Zone SoilVKNYLRLIYDKLGLWNRVELALWYEARQHDQVYHA
Ga0209169_1041715913300027879SoilEHVVKNYLRVIYDKLGLWNRVELALWYEARRHDGPVGA
Ga0209275_1041156223300027884SoilGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARKFEQIARA
Ga0209067_1055406313300027898WatershedsVRNYLSAIYDKVGVSNRVELALWYEARRHERQLLQ
Ga0209698_1029666623300027911WatershedsDSIGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
Ga0209698_1031789713300027911WatershedsGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRTESVFLTQ
Ga0209698_1031932723300027911WatershedsGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRPESVFLTQ
Ga0265354_100173913300028016RhizosphereSEVAEIIGTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRRESR
Ga0265357_102217313300028023RhizosphereMVIKNYLRVIYDKLRLWNRVELALWYEARRHREVM
Ga0255349_103634223300028090SoilTEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0307312_1090731023300028828SoilTEHVVKNYLRIIYDKLGLWNRVELALWYEARRQEIPAHA
Ga0308309_1104080213300028906SoilAEIIGTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0247271_10236613300029903SoilXXXIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRQHEPELQA
Ga0310037_1003934333300030494Peatlands SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQMYHA
Ga0310037_1009050023300030494Peatlands SoilVKNYLRVIYDKLGLWNRVELALWYEARRHEGAAQA
Ga0210270_186135523300030581SoilGLPEHVIKNYLRSIYDKLGLWNRLELALWYEAHRHQELDS
Ga0302309_1023849823300030687PalsaVKNYLRVIYDKLGLWNRVELALWYESRRGEAQLQS
Ga0311345_1056077423300030688BogVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
Ga0265459_1395726423300030741SoilKNYLRVIYDKLGLWNRVELALWYEARRHEPALSARA
Ga0138297_155499823300030962SoilYLRTIYDKLGLWNRVELALWYEARRFEGMFLAPAN
Ga0170824_11221707613300031231Forest SoilTTEHVIKNYLRTIYDKLGLWNRVELALWYEARRHEGMLLAQTN
Ga0302297_104683613300031244FenTTEHVVKNDLRVIYDKLGFWNRVELALWYEARQHEQAYAN
Ga0265340_1011318213300031247RhizosphereSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRNEQVYHA
Ga0265316_1006215233300031344RhizosphereVVKNYLRLIYDKLGLWNRVELALWYEARRHEQVYSN
Ga0310686_11739553313300031708SoilSEVAEIIGTTEYVVKNYLRVIYDKLGFWNRVELALWYEARRHESQ
Ga0310686_11744862223300031708SoilVVKNYLRVIYDKLGLWNRVELALWYEARRHESLVQV
Ga0307476_1099935123300031715Hardwood Forest SoilHVVKNYLRAIYDKLGLWNRVELALWYEARRHESLVHA
Ga0307474_1043945013300031718Hardwood Forest SoilHVVKNYLRVIYDKLGLWNRVELALWYESRRNEPQFPA
Ga0307469_1168446323300031720Hardwood Forest SoilAHVVRNYVSAIYDKIGLSRRVELALWYEARKHEDKLPRQ
Ga0307475_1033193913300031754Hardwood Forest SoilSLGTTEHVVKNYLRLIYDKLGLWNRVELALWYEARQNEQVYHA
Ga0307478_1040775513300031823Hardwood Forest SoilGTTEHVVRNYLRVIYDKLGLWNRVELALWYEARRFEQIARA
Ga0307478_1087162513300031823Hardwood Forest SoilAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHENLVQA
Ga0310910_1058107523300031946SoilAIGTTEHVVKNYLRTIYDKLGLWNRVELALWYEARRPLKV
Ga0307479_1211366923300031962Hardwood Forest SoilDAIGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARRHESLLHA
Ga0318524_1047761013300032067SoilVKNYLRVIYDKLGLWNRVELALWYEARKYEQAARA
Ga0311301_1164721213300032160Peatlands SoilIKNYLRVIYDKLGLWNRVELALWYEARRHESLARA
Ga0307472_10218681813300032205Hardwood Forest SoilVVRNYISSIYDKVGVNNRVELALWYEARQIEGRSSR
Ga0306920_10040747713300032261SoilHVVKNYLRVIYDKLGLWNRVELALWYEARKYEQTARA
Ga0310812_1001364813300032421SoilIKNYLRTIYDKLGLWNRVELALWYEARRHEQLVQVN
Ga0348332_1310951013300032515Plant LitterEHVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYQA
Ga0335082_1010990113300032782SoilEHVIKNYLRSIYDKLGLWNRVELALWYEARRHEGAAHA
Ga0335078_1085394413300032805SoilGTTEHVVKNYLRAIYDKLGLWNRVELALWYEARRHENLVRA
Ga0335084_1125078113300033004SoilDIAGSLGTTEHVIKNDLRVIYDKLGLWNRVELALWYEARRNEMA
Ga0335073_1005516813300033134SoilTTEHVVKNYLRLIYDKLGLWNRVELALWYEARRWEQAYHA
Ga0335073_1041966013300033134SoilRSIGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRFENIANA
Ga0335077_1089421513300033158SoilVKNDLRIIYNKLGFWNRVELALWYEARRNERETSLAAPGAPA
Ga0335077_1120444723300033158SoilVVKNDLRLIYDKLGLWNRVELALWYEARQFEQAYSN
Ga0334828_000355_22397_225073300033822SoilVVKNYLRLIYDKLGLWNRVELALWYEARQHEQVYNA
Ga0334828_079618_174_3023300033822SoilMGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHERVYHA
Ga0334837_009550_3003_31313300033823SoilMGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHEQVYHA
Ga0371487_0001640_27128_272383300033982Peat SoilVVKNYLRLIYDKLGLWNRVELALWYEARRHEQAYHA
Ga0371488_0017823_5225_53473300033983Peat SoilTEHVVKNYLRLIYDKLGLWNRVELALWYEARRWEQAYNVN
Ga0371488_0297598_49_1593300033983Peat SoilMVKNYLRVIYDKLGMWNRVELALWHVARQNERFHHA
Ga0371488_0413495_509_6223300033983Peat SoilMGTTEHVVKNYLRVIYDKLGLWNRVELALWYEARRHER
Ga0370483_0160725_628_7563300034124Untreated Peat SoilDAIGTTEHVVKNYLRVIYDKLGLWNRVELALWYESRRQPEMS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.