NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F000826

Metagenome / Metatranscriptome Family F000826

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F000826
Family Type Metagenome / Metatranscriptome
Number of Sequences 873
Average Sequence Length 172 residues
Representative Sequence LATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTNRNDHARQLCTKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Number of Associated Samples 460
Number of Associated Scaffolds 873

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.30 %
% of genes near scaffold ends (potentially truncated) 76.17 %
% of genes from short scaffolds (< 2000 bps) 96.91 %
Associated GOLD sequencing projects 417
AlphaFold2 3D model prediction Yes
3D model pTM-score0.72

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (96.678 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(30.470 % of family members)
Environment Ontology (ENVO) Unclassified
(68.385 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.121 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.62%    β-sheet: 0.00%    Coil/Unstructured: 38.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.72
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.47.1.1: STATd1bg1a11bg10.79
f.1.3.1: delta-Endotoxin (insectocide), N-terminal domaind1w99a11w990.69
f.1.3.0: delta-Endotoxin (insectocide), N-terminal domaind2qkga12qkg0.69
a.7.8.2: GAT-like domaind1hf8a11hf80.68
a.47.2.1: t-snare proteinsd1fioa_1fio0.67


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 873 Family Scaffolds
PF13637Ank_4 0.11



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.91 %
UnclassifiedrootN/A3.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000120|SA_S2_NOR13_50mDRAFT_c1029490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10078412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1097Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10125164All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300001263|BBAY83_10138955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300001353|JGI20159J14440_10180562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300001354|JGI20155J14468_10089351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1120Open in IMG/M
3300001354|JGI20155J14468_10103382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum998Open in IMG/M
3300001355|JGI20158J14315_10092004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1071Open in IMG/M
3300001355|JGI20158J14315_10110699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300001355|JGI20158J14315_10139855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300002692|Ga0005226J37279_1014462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300003621|JGI26083J51738_10061336All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300003621|JGI26083J51738_10082482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300004507|Ga0008280_1015943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300004507|Ga0008280_1150346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300005433|Ga0066830_10105194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300005516|Ga0066831_10110515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300005838|Ga0008649_10217079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300005941|Ga0070743_10161566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300005942|Ga0070742_10215343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300006355|Ga0075501_1360147All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300006356|Ga0075487_1419577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300006356|Ga0075487_1477068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300006356|Ga0075487_1491415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300006356|Ga0075487_1516600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300006357|Ga0075502_1580498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300006357|Ga0075502_1646087All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300006378|Ga0075498_1265469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300006382|Ga0075494_1362573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300006383|Ga0075504_1289231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WSM2598740Open in IMG/M
3300006390|Ga0075509_1213016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300006390|Ga0075509_1409173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300006392|Ga0075507_1412309All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300006393|Ga0075517_1304226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300006393|Ga0075517_1310749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300006393|Ga0075517_1546327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300006394|Ga0075492_1337063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300006397|Ga0075488_1019145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300006397|Ga0075488_1449346All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300006400|Ga0075503_1691763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum788Open in IMG/M
3300006400|Ga0075503_1693333All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300006401|Ga0075506_1633609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum784Open in IMG/M
3300006403|Ga0075514_1726068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium → unclassified Methylobacterium → Methylobacterium sp. WSM2598686Open in IMG/M
3300006403|Ga0075514_1959470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300006404|Ga0075515_10836083All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M
3300006404|Ga0075515_10965751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum722Open in IMG/M
3300006405|Ga0075510_10788275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300006425|Ga0075486_1017860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300006571|Ga0075505_1442783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300006641|Ga0075471_10316078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300006803|Ga0075467_10265288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum926Open in IMG/M
3300006803|Ga0075467_10270705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum914Open in IMG/M
3300007236|Ga0075463_10155275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300007550|Ga0102880_1069191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum935Open in IMG/M
3300007550|Ga0102880_1129262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300007551|Ga0102881_1081491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300007554|Ga0102820_1116017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300007558|Ga0102822_1053809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum954Open in IMG/M
3300007692|Ga0102823_1169251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300007716|Ga0102867_1097397All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300007863|Ga0105744_1117127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300008930|Ga0103733_1027962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300008931|Ga0103734_1031521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300008936|Ga0103739_1020297All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300008937|Ga0103740_1042010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300008938|Ga0103741_1058146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300008938|Ga0103741_1063752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300008958|Ga0104259_1014144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300008958|Ga0104259_1024047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300008958|Ga0104259_1024522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300008993|Ga0104258_1035212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum940Open in IMG/M
3300008993|Ga0104258_1044555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300008999|Ga0102816_1161840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300009002|Ga0102810_1083739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1000Open in IMG/M
3300009002|Ga0102810_1085200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum990Open in IMG/M
3300009022|Ga0103706_10064097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300009025|Ga0103707_10072122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300009025|Ga0103707_10187416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300009026|Ga0102829_1082526All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum990Open in IMG/M
3300009071|Ga0115566_10232165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1112Open in IMG/M
3300009071|Ga0115566_10240930All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1087Open in IMG/M
3300009071|Ga0115566_10311749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum925Open in IMG/M
3300009071|Ga0115566_10624770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300009172|Ga0114995_10306246All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum874Open in IMG/M
3300009193|Ga0115551_1139668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1114Open in IMG/M
3300009263|Ga0103872_1005720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1081Open in IMG/M
3300009263|Ga0103872_1022504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300009265|Ga0103873_1054127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300009357|Ga0103827_1011986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300009436|Ga0115008_10467175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300009436|Ga0115008_10485967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum881Open in IMG/M
3300009437|Ga0115556_1229094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300009437|Ga0115556_1284925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300009445|Ga0115553_1274141All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009495|Ga0115571_1182813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300009496|Ga0115570_10305412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300009507|Ga0115572_10300786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum909Open in IMG/M
3300009508|Ga0115567_10476002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300009508|Ga0115567_10611617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300009526|Ga0115004_10550750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300009543|Ga0115099_10471023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum819Open in IMG/M
3300009593|Ga0115011_10949895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300009599|Ga0115103_1195900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300009599|Ga0115103_1226469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300009599|Ga0115103_1227048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300009599|Ga0115103_1300903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300009599|Ga0115103_1537855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300009599|Ga0115103_1688518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300009606|Ga0115102_10445135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300009606|Ga0115102_10598774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300009606|Ga0115102_10838876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300009606|Ga0115102_10937278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300009608|Ga0115100_10684412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300009677|Ga0115104_10041863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300009677|Ga0115104_10137341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300009677|Ga0115104_10174694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300009677|Ga0115104_10199101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300009677|Ga0115104_10210253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300009677|Ga0115104_10436356All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300009677|Ga0115104_10631794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300009677|Ga0115104_10909166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300009677|Ga0115104_10949922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum858Open in IMG/M
3300009677|Ga0115104_10952133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300009677|Ga0115104_11182395All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300009679|Ga0115105_10418680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300009679|Ga0115105_10590862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300009679|Ga0115105_10837778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300009679|Ga0115105_11080410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300009679|Ga0115105_11413280All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300009705|Ga0115000_10449861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum816Open in IMG/M
3300009719|Ga0123383_108774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300009735|Ga0123377_1084131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300009785|Ga0115001_10276144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1070Open in IMG/M
3300009785|Ga0115001_10363568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum909Open in IMG/M
3300009785|Ga0115001_10540038All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300009790|Ga0115012_10628832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300009790|Ga0115012_11203360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300010370|Ga0129336_10296093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300010883|Ga0133547_11973813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1070Open in IMG/M
3300010981|Ga0138316_10135550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300010981|Ga0138316_10549880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300010981|Ga0138316_11476095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300010981|Ga0138316_11600010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum663Open in IMG/M
3300010985|Ga0138326_10041068All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300010985|Ga0138326_11169489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300010985|Ga0138326_11247182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300010985|Ga0138326_11248676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300010985|Ga0138326_11289989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum777Open in IMG/M
3300010985|Ga0138326_11367854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300010985|Ga0138326_12117303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300010986|Ga0138327_11833103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300010987|Ga0138324_10233508All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300010987|Ga0138324_10291198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300010987|Ga0138324_10340149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300010987|Ga0138324_10537150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300010987|Ga0138324_10590940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300012030|Ga0136599_1021854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300012036|Ga0136600_1053743All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300012370|Ga0123369_1006564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300012408|Ga0138265_1112779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300012413|Ga0138258_1672832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300012414|Ga0138264_1171485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300012415|Ga0138263_1805281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300012417|Ga0138262_1101348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300012418|Ga0138261_1030927All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300012418|Ga0138261_1220703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300012419|Ga0138260_10344995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300012470|Ga0129329_1046656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300012471|Ga0129334_1064072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300012504|Ga0129347_1083821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum865Open in IMG/M
3300012504|Ga0129347_1128564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300012504|Ga0129347_1290126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300012516|Ga0129325_1192471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300012518|Ga0129349_1018882All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300012518|Ga0129349_1041485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300012518|Ga0129349_1084024All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300012518|Ga0129349_1298287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300012520|Ga0129344_1008776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300012520|Ga0129344_1009389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300012520|Ga0129344_1364375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300012522|Ga0129326_1299632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300012523|Ga0129350_1092550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300012523|Ga0129350_1357630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300012523|Ga0129350_1376641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300012525|Ga0129353_1356733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum770Open in IMG/M
3300012525|Ga0129353_1596668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300012528|Ga0129352_10349496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300012528|Ga0129352_10701570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300012767|Ga0138267_1256408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300012953|Ga0163179_11948243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300012954|Ga0163111_11393678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300012954|Ga0163111_11932124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300012962|Ga0129335_1113639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300012962|Ga0129335_1143169All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300012963|Ga0129340_1040837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300012963|Ga0129340_1118054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300012963|Ga0129340_1152097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300012963|Ga0129340_1152994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300012963|Ga0129340_1367180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300012965|Ga0129346_1117779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum869Open in IMG/M
3300012965|Ga0129346_1197360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300012965|Ga0129346_1231327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300012967|Ga0129343_1131519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300012968|Ga0129337_1259503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300012968|Ga0129337_1287343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300012968|Ga0129337_1323173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300012970|Ga0129338_1445516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300013110|Ga0171652_1084301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum770Open in IMG/M
3300016729|Ga0182056_1249567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300016731|Ga0182094_1277720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300016732|Ga0182057_1003384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300016735|Ga0182074_1065498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum788Open in IMG/M
3300016740|Ga0182096_1189414All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum752Open in IMG/M
3300016741|Ga0182079_1704398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300016748|Ga0182043_1113911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300016754|Ga0182072_1458819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300016754|Ga0182072_1533610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300016766|Ga0182091_1055543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300016766|Ga0182091_1174479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300016771|Ga0182082_1249300All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300017710|Ga0181403_1051475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300017781|Ga0181423_1256659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300017782|Ga0181380_1238489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300017818|Ga0181565_10611587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum698Open in IMG/M
3300017951|Ga0181577_10488000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300017957|Ga0181571_10622796All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300017958|Ga0181582_10547076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300017964|Ga0181589_10735071All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum616Open in IMG/M
3300018049|Ga0181572_10944839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018418|Ga0181567_10453069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300018426|Ga0181566_10446695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum914Open in IMG/M
3300018515|Ga0192960_102818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum814Open in IMG/M
3300018538|Ga0193022_102066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300018565|Ga0188826_112139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum725Open in IMG/M
3300018567|Ga0188858_107486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300018599|Ga0188834_1019109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300018617|Ga0193133_1023459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018618|Ga0193204_1013126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300018619|Ga0188877_1013040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300018622|Ga0188862_1010776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum815Open in IMG/M
3300018625|Ga0192842_1023698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum666Open in IMG/M
3300018625|Ga0192842_1035880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300018628|Ga0193355_1020895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum618Open in IMG/M
3300018655|Ga0192846_1022384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300018661|Ga0193122_1062515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300018665|Ga0188882_1018987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018674|Ga0193166_1010915All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300018681|Ga0193206_1018856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300018684|Ga0192983_1030993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum735Open in IMG/M
3300018692|Ga0192944_1023864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum871Open in IMG/M
3300018692|Ga0192944_1024320All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300018692|Ga0192944_1029436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300018692|Ga0192944_1032572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300018692|Ga0192944_1035190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300018692|Ga0192944_1037449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300018701|Ga0193405_1034138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300018701|Ga0193405_1038343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018701|Ga0193405_1041883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300018716|Ga0193324_1041764All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300018724|Ga0193391_1020645All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300018724|Ga0193391_1027761All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300018725|Ga0193517_1037025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300018725|Ga0193517_1071455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018730|Ga0192967_1035522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300018730|Ga0192967_1056192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300018732|Ga0193381_1052371All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300018735|Ga0193544_1017411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300018735|Ga0193544_1022402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300018742|Ga0193138_1023485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300018742|Ga0193138_1030785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300018745|Ga0193000_1039890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300018745|Ga0193000_1039891All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300018749|Ga0193392_1032306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300018749|Ga0193392_1044025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300018759|Ga0192883_1036236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum763Open in IMG/M
3300018763|Ga0192827_1085329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300018765|Ga0193031_1031914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300018765|Ga0193031_1032733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300018765|Ga0193031_1048713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300018765|Ga0193031_1061449All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300018765|Ga0193031_1068408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300018765|Ga0193031_1078798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum557Open in IMG/M
3300018765|Ga0193031_1083686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300018765|Ga0193031_1093827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300018766|Ga0193181_1048779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300018766|Ga0193181_1069275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300018768|Ga0193503_1043406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300018773|Ga0193396_1055429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300018776|Ga0193407_1042267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300018779|Ga0193149_1030901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300018779|Ga0193149_1043491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300018781|Ga0193380_1060469All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018791|Ga0192950_1038232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300018801|Ga0192824_1092817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018823|Ga0193053_1043973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300018823|Ga0193053_1072952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018825|Ga0193048_1035779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300018826|Ga0193394_1060981All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018826|Ga0193394_1076997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300018831|Ga0192949_1078767All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300018832|Ga0194240_1007149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300018832|Ga0194240_1007345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum829Open in IMG/M
3300018832|Ga0194240_1015725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018832|Ga0194240_1023429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300018836|Ga0192870_1052335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300018838|Ga0193302_1040097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300018838|Ga0193302_1040540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300018842|Ga0193219_1031391All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum808Open in IMG/M
3300018842|Ga0193219_1041227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300018842|Ga0193219_1045686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300018842|Ga0193219_1059822All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300018846|Ga0193253_1067239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300018846|Ga0193253_1074604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300018855|Ga0193475_1037514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300018855|Ga0193475_1082099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018862|Ga0193308_1061355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300018871|Ga0192978_1044952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum830Open in IMG/M
3300018871|Ga0192978_1071770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum639Open in IMG/M
3300018874|Ga0192977_1048807All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum860Open in IMG/M
3300018880|Ga0193337_1038759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300018886|Ga0193185_1074577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300018886|Ga0193185_1075191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300018905|Ga0193028_1090538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300018905|Ga0193028_1121513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300018913|Ga0192868_10037825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300018913|Ga0192868_10054974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018922|Ga0193420_10069789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018926|Ga0192989_10082999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300018926|Ga0192989_10121381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300018932|Ga0192820_10073262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300018942|Ga0193426_10138020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018955|Ga0193379_10104616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300018955|Ga0193379_10136425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300018955|Ga0193379_10136430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum692Open in IMG/M
3300018967|Ga0193178_10021529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300018967|Ga0193178_10060315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300018968|Ga0192894_10213904All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300018974|Ga0192873_10275231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300018976|Ga0193254_10073505All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300018977|Ga0193353_10155974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018977|Ga0193353_10169161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300018977|Ga0193353_10193512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018980|Ga0192961_10091438All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300018980|Ga0192961_10107056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300018980|Ga0192961_10110144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum836Open in IMG/M
3300018980|Ga0192961_10110727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300018980|Ga0192961_10116325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300018980|Ga0192961_10125962All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300018980|Ga0192961_10130352All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum766Open in IMG/M
3300018980|Ga0192961_10170488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum660Open in IMG/M
3300018982|Ga0192947_10121674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300018982|Ga0192947_10131029All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300018982|Ga0192947_10135956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum821Open in IMG/M
3300018982|Ga0192947_10157125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum758Open in IMG/M
3300018982|Ga0192947_10167905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300018982|Ga0192947_10169437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300018982|Ga0192947_10170283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300018982|Ga0192947_10229480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300018982|Ga0192947_10237106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300018989|Ga0193030_10099517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum891Open in IMG/M
3300018989|Ga0193030_10101944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum883Open in IMG/M
3300018989|Ga0193030_10114178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum845Open in IMG/M
3300018989|Ga0193030_10117002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum837Open in IMG/M
3300018989|Ga0193030_10124839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum816Open in IMG/M
3300018989|Ga0193030_10130325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum801Open in IMG/M
3300018989|Ga0193030_10141158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300018989|Ga0193030_10157260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300018989|Ga0193030_10164612All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum722Open in IMG/M
3300018989|Ga0193030_10169875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300018989|Ga0193030_10179472All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300018989|Ga0193030_10216116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300018989|Ga0193030_10220255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300018989|Ga0193030_10223844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300018989|Ga0193030_10263700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018997|Ga0193257_10167605All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300019001|Ga0193034_10119582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300019001|Ga0193034_10128180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300019009|Ga0192880_10077766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300019009|Ga0192880_10119219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300019010|Ga0193044_10176360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300019010|Ga0193044_10183442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300019021|Ga0192982_10144453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300019021|Ga0192982_10145982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300019021|Ga0192982_10170089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum769Open in IMG/M
3300019022|Ga0192951_10195049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300019025|Ga0193545_10076510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300019025|Ga0193545_10120037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019027|Ga0192909_10049795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum904Open in IMG/M
3300019031|Ga0193516_10127394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300019031|Ga0193516_10129217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum858Open in IMG/M
3300019031|Ga0193516_10136317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300019031|Ga0193516_10136386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300019031|Ga0193516_10307517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300019032|Ga0192869_10161144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum931Open in IMG/M
3300019032|Ga0192869_10161165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum931Open in IMG/M
3300019032|Ga0192869_10188227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum872Open in IMG/M
3300019032|Ga0192869_10216782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum819Open in IMG/M
3300019032|Ga0192869_10226534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum803Open in IMG/M
3300019032|Ga0192869_10243322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum777Open in IMG/M
3300019032|Ga0192869_10245883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300019032|Ga0192869_10278763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300019032|Ga0192869_10292192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300019032|Ga0192869_10303837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300019032|Ga0192869_10328052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300019032|Ga0192869_10498126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300019033|Ga0193037_10140181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300019033|Ga0193037_10229117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300019033|Ga0193037_10361120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019036|Ga0192945_10110825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum869Open in IMG/M
3300019036|Ga0192945_10112739All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300019036|Ga0192945_10143243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300019036|Ga0192945_10168732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300019036|Ga0192945_10186905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300019036|Ga0192945_10211692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300019036|Ga0192945_10246633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300019037|Ga0192886_10277208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300019039|Ga0193123_10339630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300019039|Ga0193123_10392218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300019045|Ga0193336_10132047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum898Open in IMG/M
3300019045|Ga0193336_10219376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300019045|Ga0193336_10273814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300019045|Ga0193336_10273854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300019045|Ga0193336_10344429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300019045|Ga0193336_10483813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019045|Ga0193336_10663362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300019047|Ga0193549_10050539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300019048|Ga0192981_10160903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum886Open in IMG/M
3300019048|Ga0192981_10187379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum811Open in IMG/M
3300019048|Ga0192981_10188847All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum807Open in IMG/M
3300019048|Ga0192981_10284251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300019049|Ga0193082_10405269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300019050|Ga0192966_10159787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300019050|Ga0192966_10166819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum785Open in IMG/M
3300019050|Ga0192966_10315844All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300019050|Ga0192966_10338839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300019051|Ga0192826_10186889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum766Open in IMG/M
3300019051|Ga0192826_10191577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum756Open in IMG/M
3300019051|Ga0192826_10209475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum720Open in IMG/M
3300019051|Ga0192826_10215418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum709Open in IMG/M
3300019084|Ga0193051_112931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019095|Ga0188866_1014641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300019095|Ga0188866_1015110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300019095|Ga0188866_1015672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300019095|Ga0188866_1016970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300019097|Ga0193153_1013415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum831Open in IMG/M
3300019097|Ga0193153_1013887All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300019103|Ga0192946_1039330All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300019116|Ga0193243_1023726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum817Open in IMG/M
3300019116|Ga0193243_1028763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300019116|Ga0193243_1031842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum721Open in IMG/M
3300019116|Ga0193243_1032128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300019116|Ga0193243_1033652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum704Open in IMG/M
3300019116|Ga0193243_1035738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300019116|Ga0193243_1039138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300019116|Ga0193243_1061900All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300019117|Ga0193054_1057215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300019118|Ga0193157_1027119All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300019118|Ga0193157_1033400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019118|Ga0193157_1035054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300019123|Ga0192980_1042037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum875Open in IMG/M
3300019123|Ga0192980_1057943All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300019123|Ga0192980_1058671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300019123|Ga0192980_1060679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300019123|Ga0192980_1066716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300019123|Ga0192980_1083777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300019125|Ga0193104_1018063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum923Open in IMG/M
3300019129|Ga0193436_1044263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300019129|Ga0193436_1050154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300019131|Ga0193249_1097000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300019131|Ga0193249_1118144All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300019133|Ga0193089_1076557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300019149|Ga0188870_10071184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300019149|Ga0188870_10072956All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum836Open in IMG/M
3300019149|Ga0188870_10085793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300019149|Ga0188870_10110002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum655Open in IMG/M
3300019150|Ga0194244_10074653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300019196|Ga0182087_1170805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum597Open in IMG/M
3300019200|Ga0180036_1008833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300019253|Ga0182064_1062999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300019261|Ga0182097_1404523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300019262|Ga0182066_1344091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300019262|Ga0182066_1466987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300019266|Ga0182061_1580229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300019272|Ga0182059_1004697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300019272|Ga0182059_1448192All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300019272|Ga0182059_1462076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300019274|Ga0182073_1152668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300019274|Ga0182073_1385081All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300019276|Ga0182067_1667222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum969Open in IMG/M
3300019277|Ga0182081_1190486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300019282|Ga0182075_1068201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300019282|Ga0182075_1114550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300019283|Ga0182058_1329698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300019283|Ga0182058_1493033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum788Open in IMG/M
3300019283|Ga0182058_1543521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300020013|Ga0182086_1004840All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300020014|Ga0182044_1129842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300020182|Ga0206129_10285888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300021085|Ga0206677_10218832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300021169|Ga0206687_1077012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300021169|Ga0206687_1314528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300021169|Ga0206687_1495565All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300021169|Ga0206687_1682735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300021334|Ga0206696_1489098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300021342|Ga0206691_1035462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300021342|Ga0206691_1194950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300021342|Ga0206691_1268211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300021342|Ga0206691_1626640All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300021342|Ga0206691_1759288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300021345|Ga0206688_10128863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300021345|Ga0206688_10175578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300021345|Ga0206688_10625989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300021345|Ga0206688_10697738All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300021345|Ga0206688_11089708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300021348|Ga0206695_1025199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300021350|Ga0206692_1166960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300021350|Ga0206692_1174461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300021350|Ga0206692_1632577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300021350|Ga0206692_1848975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300021353|Ga0206693_1464726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300021353|Ga0206693_1815000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300021355|Ga0206690_10328495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300021355|Ga0206690_10350717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300021359|Ga0206689_10083872All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300021359|Ga0206689_10340136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300021359|Ga0206689_11111063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300021365|Ga0206123_10192211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum912Open in IMG/M
3300021365|Ga0206123_10215030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300021378|Ga0213861_10452736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300021379|Ga0213864_10274413All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300021867|Ga0063130_113510All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300021872|Ga0063132_110552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300021875|Ga0063146_103959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300021876|Ga0063124_144820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300021885|Ga0063125_1016735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300021887|Ga0063105_1044562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300021888|Ga0063122_1028348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300021889|Ga0063089_1043459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300021897|Ga0063873_1020709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300021899|Ga0063144_1108858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300021901|Ga0063119_1022920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300021902|Ga0063086_1052028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300021904|Ga0063131_1023036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300021905|Ga0063088_1068402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300021908|Ga0063135_1061340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300021912|Ga0063133_1020861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum846Open in IMG/M
3300021912|Ga0063133_1030716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300021912|Ga0063133_1031788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300021912|Ga0063133_1050001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300021922|Ga0063869_1036340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300021924|Ga0063085_1045578All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300021924|Ga0063085_1045579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300021925|Ga0063096_1000277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum844Open in IMG/M
3300021925|Ga0063096_1037725All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum836Open in IMG/M
3300021925|Ga0063096_1037726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300021927|Ga0063103_1051647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum826Open in IMG/M
3300021930|Ga0063145_1023874All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300021930|Ga0063145_1104858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300021933|Ga0063756_1012509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300021934|Ga0063139_1152547All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300021935|Ga0063138_1128517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300021939|Ga0063095_1048604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300021940|Ga0063108_1018085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300021941|Ga0063102_1020521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300021943|Ga0063094_1016122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300021943|Ga0063094_1050545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum801Open in IMG/M
3300021950|Ga0063101_1048837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021950|Ga0063101_1093671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300021950|Ga0063101_1136260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300021954|Ga0063755_1013459All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300021954|Ga0063755_1064817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300021957|Ga0222717_10274091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum972Open in IMG/M
3300021959|Ga0222716_10486503All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300021961|Ga0222714_10328342All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum829Open in IMG/M
3300021962|Ga0222713_10306467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1009Open in IMG/M
3300021962|Ga0222713_10363877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300022934|Ga0255781_10185539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1036Open in IMG/M
3300023108|Ga0255784_10228714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum964Open in IMG/M
3300023566|Ga0228679_1014436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300023566|Ga0228679_1036099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300023674|Ga0228697_112287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum808Open in IMG/M
3300023676|Ga0232114_117499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300023683|Ga0228681_1021476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300023694|Ga0228683_1015157All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300023695|Ga0228680_1043155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300023698|Ga0228682_1035798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum668Open in IMG/M
3300023704|Ga0228684_1063659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
(restricted) 3300024252|Ga0233435_1100122All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum968Open in IMG/M
(restricted) 3300024261|Ga0233439_10184322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum968Open in IMG/M
3300024343|Ga0244777_10271092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1076Open in IMG/M
3300024346|Ga0244775_10514778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum976Open in IMG/M
3300025626|Ga0209716_1088035All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum909Open in IMG/M
3300025636|Ga0209136_1119132All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300025680|Ga0209306_1131233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300025690|Ga0209505_1066198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1112Open in IMG/M
3300025704|Ga0209602_1171810All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300025830|Ga0209832_1145653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300025849|Ga0209603_1282713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300025869|Ga0209308_10231531All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300025869|Ga0209308_10402935All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300025872|Ga0208783_10156138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum966Open in IMG/M
3300025879|Ga0209555_10161579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum925Open in IMG/M
3300025881|Ga0209309_10243243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum841Open in IMG/M
3300025887|Ga0208544_10168686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum926Open in IMG/M
3300025890|Ga0209631_10189010All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1071Open in IMG/M
3300025890|Ga0209631_10198888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1033Open in IMG/M
3300025894|Ga0209335_10411700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300025897|Ga0209425_10245759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum925Open in IMG/M
3300026130|Ga0209961_1050893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300026403|Ga0247557_1031117All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300026403|Ga0247557_1031751All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300026443|Ga0247559_1100589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300026447|Ga0247607_1041193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum800Open in IMG/M
3300026447|Ga0247607_1053468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300026447|Ga0247607_1096205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300026448|Ga0247594_1032241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum884Open in IMG/M
3300026448|Ga0247594_1047794All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300026448|Ga0247594_1059548All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum659Open in IMG/M
3300026449|Ga0247593_1060577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300026458|Ga0247578_1052403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300026461|Ga0247600_1045251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300026465|Ga0247588_1046703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum850Open in IMG/M
3300026468|Ga0247603_1053769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum813Open in IMG/M
3300026470|Ga0247599_1054594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300026470|Ga0247599_1092617All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300026495|Ga0247571_1059185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300026495|Ga0247571_1088017All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300026495|Ga0247571_1111799All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300026495|Ga0247571_1167570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300026500|Ga0247592_1070834All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300026500|Ga0247592_1077266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum808Open in IMG/M
3300026500|Ga0247592_1078811All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum799Open in IMG/M
3300026504|Ga0247587_1071513All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300027159|Ga0208020_1033422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum990Open in IMG/M
3300027188|Ga0208921_1025382All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum900Open in IMG/M
3300027236|Ga0208026_1034589All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum714Open in IMG/M
3300027687|Ga0209710_1136477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300027757|Ga0208671_10154400All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum833Open in IMG/M
3300027780|Ga0209502_10203339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum910Open in IMG/M
3300027833|Ga0209092_10262694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum946Open in IMG/M
3300027906|Ga0209404_10446185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300028110|Ga0247584_1102439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300028110|Ga0247584_1125802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300028110|Ga0247584_1127798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300028134|Ga0256411_1122937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300028134|Ga0256411_1189001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300028137|Ga0256412_1156653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum841Open in IMG/M
3300028137|Ga0256412_1162285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300028137|Ga0256412_1178631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum784Open in IMG/M
3300028137|Ga0256412_1184124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300028137|Ga0256412_1197033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300028137|Ga0256412_1199581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum739Open in IMG/M
3300028137|Ga0256412_1224648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum693Open in IMG/M
3300028233|Ga0256417_1086209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300028233|Ga0256417_1088937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300028233|Ga0256417_1147669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300028282|Ga0256413_1157000All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300028282|Ga0256413_1162937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300028282|Ga0256413_1172989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300028282|Ga0256413_1178099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300028282|Ga0256413_1182678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300028282|Ga0256413_1196646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300028282|Ga0256413_1331951All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300028282|Ga0256413_1332287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300028290|Ga0247572_1078568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum805Open in IMG/M
3300028290|Ga0247572_1081045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300028290|Ga0247572_1087160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300028290|Ga0247572_1105522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300028333|Ga0247595_1043730All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300028334|Ga0247597_1046259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300028335|Ga0247566_1031185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum872Open in IMG/M
3300028335|Ga0247566_1064494All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300028412|Ga0306910_1027832All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300028575|Ga0304731_10498902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum786Open in IMG/M
3300028575|Ga0304731_10721488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300028575|Ga0304731_10754976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300028575|Ga0304731_11114818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300028595|Ga0272440_1164088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300028595|Ga0272440_1171421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum687Open in IMG/M
3300028671|Ga0257132_1124944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300030653|Ga0307402_10470006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum728Open in IMG/M
3300030671|Ga0307403_10316666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum832Open in IMG/M
3300030699|Ga0307398_10359501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300030699|Ga0307398_10367082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300030699|Ga0307398_10384042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300030699|Ga0307398_10804220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300030702|Ga0307399_10247677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum836Open in IMG/M
3300030702|Ga0307399_10293997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300030702|Ga0307399_10363905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum697Open in IMG/M
3300030715|Ga0308127_1027549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300030715|Ga0308127_1031006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300030715|Ga0308127_1037593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300030720|Ga0308139_1031370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum784Open in IMG/M
3300030724|Ga0308138_1035173All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300030725|Ga0308128_1027370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300030725|Ga0308128_1029741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300030726|Ga0308126_1034211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum718Open in IMG/M
3300030729|Ga0308131_1071100All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300030780|Ga0073988_10025478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300030780|Ga0073988_12063895All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum882Open in IMG/M
3300030856|Ga0073990_12038310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300030856|Ga0073990_12043278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300030857|Ga0073981_11709626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum570Open in IMG/M
3300030857|Ga0073981_11716073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300030912|Ga0073987_11147924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300030912|Ga0073987_11222638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300030948|Ga0073977_1500421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300030954|Ga0073942_11766056All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300030954|Ga0073942_11866045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300030955|Ga0073943_11632843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300030956|Ga0073944_11279021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300031004|Ga0073984_11249628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300031032|Ga0073980_10004692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum696Open in IMG/M
3300031032|Ga0073980_10005025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300031037|Ga0073979_10010619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300031037|Ga0073979_12447250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300031062|Ga0073989_10011181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300031062|Ga0073989_10015258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300031062|Ga0073989_10022984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum656Open in IMG/M
3300031062|Ga0073989_13471374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300031062|Ga0073989_13537670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300031062|Ga0073989_13567484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300031062|Ga0073989_13602802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300031126|Ga0073962_11262094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300031216|Ga0307980_1048642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum928Open in IMG/M
3300031223|Ga0307981_1124920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300031378|Ga0308145_1043886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300031522|Ga0307388_10506224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum795Open in IMG/M
3300031522|Ga0307388_10546582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum765Open in IMG/M
3300031522|Ga0307388_10580502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300031522|Ga0307388_10640310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300031522|Ga0307388_11200182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300031523|Ga0307492_10210957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300031523|Ga0307492_10264922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300031540|Ga0308143_117983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300031542|Ga0308149_1018511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum873Open in IMG/M
3300031542|Ga0308149_1020746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300031558|Ga0308147_1033999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300031569|Ga0307489_10304518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1031Open in IMG/M
3300031569|Ga0307489_10362101All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum956Open in IMG/M
3300031569|Ga0307489_10501718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300031570|Ga0308144_1044527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300031579|Ga0308134_1071290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300031621|Ga0302114_10171094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum936Open in IMG/M
3300031622|Ga0302126_10084602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1259Open in IMG/M
3300031638|Ga0302125_10091332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1005Open in IMG/M
3300031638|Ga0302125_10235982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300031674|Ga0307393_1056091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum818Open in IMG/M
3300031674|Ga0307393_1079465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300031702|Ga0307998_1171154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300031710|Ga0307386_10292213All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum816Open in IMG/M
3300031710|Ga0307386_10330043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300031710|Ga0307386_10401165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum706Open in IMG/M
3300031710|Ga0307386_10507920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300031710|Ga0307386_10548554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300031710|Ga0307386_10645263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300031710|Ga0307386_10722886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300031717|Ga0307396_10533049All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300031725|Ga0307381_10151520All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300031725|Ga0307381_10157487All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300031725|Ga0307381_10263427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300031725|Ga0307381_10285515All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300031725|Ga0307381_10286375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300031725|Ga0307381_10375497All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300031729|Ga0307391_10386419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300031729|Ga0307391_10390325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum770Open in IMG/M
3300031729|Ga0307391_10416629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300031729|Ga0307391_10427265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300031729|Ga0307391_10931339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300031734|Ga0307397_10325036All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300031735|Ga0307394_10190435All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum804Open in IMG/M
3300031735|Ga0307394_10228820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300031735|Ga0307394_10282209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300031737|Ga0307387_10466580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum778Open in IMG/M
3300031737|Ga0307387_10596107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum690Open in IMG/M
3300031737|Ga0307387_10839247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300031738|Ga0307384_10298284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300031738|Ga0307384_10329491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum701Open in IMG/M
3300031738|Ga0307384_10455865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300031739|Ga0307383_10340421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300031739|Ga0307383_10362554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300031739|Ga0307383_10384595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300031739|Ga0307383_10431165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300031739|Ga0307383_10680952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300031742|Ga0307395_10393666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300031742|Ga0307395_10542880All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300031743|Ga0307382_10211720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300031743|Ga0307382_10309218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300031743|Ga0307382_10382539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300031752|Ga0307404_10233719All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum759Open in IMG/M
3300031752|Ga0307404_10246675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300032011|Ga0315316_10668457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum864Open in IMG/M
3300032150|Ga0314779_1014207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300032150|Ga0314779_1027623All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300032463|Ga0314684_10411448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum794Open in IMG/M
3300032470|Ga0314670_10517249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300032481|Ga0314668_10306181All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum822Open in IMG/M
3300032491|Ga0314675_10375080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum711Open in IMG/M
3300032491|Ga0314675_10439074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300032492|Ga0314679_10280908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum761Open in IMG/M
3300032517|Ga0314688_10329771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum818Open in IMG/M
3300032517|Ga0314688_10497209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300032518|Ga0314689_10384332All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300032518|Ga0314689_10444656All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300032518|Ga0314689_10479899All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum651Open in IMG/M
3300032519|Ga0314676_10393902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300032521|Ga0314680_10680037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum650Open in IMG/M
3300032521|Ga0314680_10708734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300032522|Ga0314677_10463139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300032615|Ga0314674_10457557All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum661Open in IMG/M
3300032616|Ga0314671_10460291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300032616|Ga0314671_10736061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300032617|Ga0314683_10566573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300032617|Ga0314683_10784679All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300032650|Ga0314673_10605261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300032651|Ga0314685_10363496All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum802Open in IMG/M
3300032651|Ga0314685_10469389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300032666|Ga0314678_10284575All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300032707|Ga0314687_10317475All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum850Open in IMG/M
3300032707|Ga0314687_10426973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300032707|Ga0314687_10604385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300032708|Ga0314669_10521959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300032709|Ga0314672_1211581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300032711|Ga0314681_10369554All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum801Open in IMG/M
3300032711|Ga0314681_10555749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300032713|Ga0314690_10466873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300032713|Ga0314690_10586551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300032727|Ga0314693_10357484All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300032727|Ga0314693_10381581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300032734|Ga0314706_10244314All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300032734|Ga0314706_10617748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300032743|Ga0314707_10627471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300032744|Ga0314705_10459671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300032745|Ga0314704_10325519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum850Open in IMG/M
3300032746|Ga0314701_10203997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum885Open in IMG/M
3300032746|Ga0314701_10336242All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum685Open in IMG/M
3300032746|Ga0314701_10377467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300032746|Ga0314701_10444913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300032748|Ga0314713_10227609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300032749|Ga0314691_10434960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300032751|Ga0314694_10407287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300032752|Ga0314700_10413201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum717Open in IMG/M
3300032754|Ga0314692_10552720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300032755|Ga0314709_10444958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum797Open in IMG/M
3300032820|Ga0310342_101160120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum912Open in IMG/M
3300033572|Ga0307390_10835440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine30.47%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous8.13%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater7.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.81%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.21%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.63%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.06%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.60%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.15%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.03%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.03%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.69%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.57%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.57%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.57%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.34%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.34%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.34%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.34%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.34%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.34%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.23%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.23%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.23%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.23%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.23%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.23%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.23%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.11%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.11%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.11%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.11%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.11%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.11%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.11%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300001263Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY83Host-AssociatedOpen in IMG/M
3300001353Pelagic Microbial community sample from North Sea - COGITO 998_met_09EnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300002692Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003621Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNAEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005433Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45BEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006394Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007558Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733EnvironmentalOpen in IMG/M
3300007692Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007863Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459B_0.2umEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008937Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3CEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009026Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009496Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009719Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_260_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010986Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 9)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012036Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012470Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013110Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017958Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017964Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018538Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_147 - TARA_N000002101 (ERX1789665-ERR1719366)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018617Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000604 (ERX1782236-ERR1711896)EnvironmentalOpen in IMG/M
3300018618Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000071 (ERX1782354-ERR1712005)EnvironmentalOpen in IMG/M
3300018619Metatranscriptome of marine microbial communities from Baltic Sea - GS855_ls4EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018665Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018716Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001728 (ERX1789726-ERR1719299)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018725Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782256-ERR1712230)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018749Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789662-ERR1719448)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018768Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003011 (ERX1789448-ERR1719377)EnvironmentalOpen in IMG/M
3300018773Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789391-ERR1719301)EnvironmentalOpen in IMG/M
3300018776Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789638-ERR1719404)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018781Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789655-ERR1719256)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018826Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789587-ERR1719214)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018838Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001646 (ERX1789439-ERR1719515)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018886Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000029 (ERX1782302-ERR1711968)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018932Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000051 (ERX1782293-ERR1711916)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019047Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399746-ERR1328125)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019196Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019274Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019277Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021867Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S3 C1 B8 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021876Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-18 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021885Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-19 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021888Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-16 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021899Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S27 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021939Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-37M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023674Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 90R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023676Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 55R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023683Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023695Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 21R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023704Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 35R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024252 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_135_MGEnvironmentalOpen in IMG/M
3300024261 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_100_MGEnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025680Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026130Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026443Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 4R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026500Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 54R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027236Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027687Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028412Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #698 (v2)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030726Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1292_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030729Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030856Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S23_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030948Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E7_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030955Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030956Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031004Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S12_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031032Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031037Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S2_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031216Marine microbial communities from Ellis Fjord, Antarctic Ocean - #1060EnvironmentalOpen in IMG/M
3300031223Marine microbial communities from Ellis Fjord, Antarctic Ocean - #987EnvironmentalOpen in IMG/M
3300031378Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_319_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031558Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_325_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032748Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032749Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR13_50mDRAFT_102949013300000120MarineDIAAHESARNEAAKIKKNPQAELLATIKADLDQISKDLSFGVSYSQEKRNDHARTLCTKVGTAIYGYASGITAQVEANTNESMTEMNAHNISAMIFYDVQVQDFAKGLGMASNDDLILAVNRLKSLQKLYLFEQKGGENYLG*
SA_S1_NOR08_45mDRAFT_1007841213300000128MarineMKFLTYCALIAVTAAVQRHHHHPHSNELVATLPDVRADTVSDEDIAAHESARNEAAKIKKNPQAELLATIKADLDQISKDLSFGVSYSQEKRNDHARTLCTKVGTAIYGYASGITAQVEANTNESMTEMNAHNISAMIFYDVQVQDFAKGLGMASNDDLILAVNRLKSLQKLYLFEQKGGENYLG*
KGI_S1_ANT02_95mDRAFT_1012516413300000136MarineMKLLSLSAIAMLVASSDAASINRHNIKGVTFIQTLPDQRGDTVTEKDIAAHEAARAEAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTAKIANAIKDYANKLITTVDKSPNEALTEQNAHNIASMIFYDVQLEDSMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENY
BBAY83_1013895513300001263Macroalgal SurfaceMKFLSLSVAMLVASTEAASLNRHHVKGVTFVQTLPDVRADTVTEKDIAAHEAARADAAKVKKNPQASLLQSIRSDLEEVNLECSFGVSFSQNPRNNRARALSTKIANGIKDYTNKLIQTVDKSPNDALTEQNAHNIASLIFYDVQLEENMKTLGMDEDKELSVSVNRLKSLQKLYLFEQKGGENYLS*
JGI20159J14440_1018056213300001353Pelagic MarineSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
JGI20155J14468_1008935113300001354Pelagic MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*VR*
JGI20155J14468_1010338223300001354Pelagic MarineMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*S*MSFVLCVESQ*
JGI20158J14315_1009200413300001355Pelagic MarineMKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKAGGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLG*AA*CFSRKKHQIAEK*
JGI20158J14315_1011069913300001355Pelagic MarineMKFLTLSAFAMLLANTEAITIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANTDLNLAINRLKSLQKLYLFEQKGGENYLG*
JGI20158J14315_1013985513300001355Pelagic MarineDVRADTVSDEDIAAHEAARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG*AY*RGTTPQQ*
Ga0005226J37279_101446213300002692MarineIMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLSTIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDDLVLAV
JGI26083J51738_1006133613300003621MarineMKFIATLAVALLVCNTEATSLLRRHHHPHSHELVATLPDERPEVVSEADIAAREAARAEAAKVRKNPQAALLASMRADLEQINTDMSFGVSYSQGKRNDEARGLCTKVASAIKQYAKQLIGKVDGGAKSGQPVLTEQNAHNIASVIFYDVQLEDAMKGLGMAEDGELVLAVNRLKSLQKLYLFEQQGGXNYLE*
JGI26083J51738_1008248213300003621MarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRLKSLQKLYLFEQKGG
Ga0008280_101594313300004507MarineRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0008280_115034613300004507MarinePHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKADLDQISKDLSFGVSYSQAKRNDHARTLCTKVGEAILGYADGITAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMASNDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0066830_1010519413300005433MarineHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0066831_1011051513300005516MarineMKFLKYTAVLALFLHSTDALQTLPDVRSDTVADADIAAHEAARAEAAKVKKNPQTALLASIKADLEAINTNMSFGISYSQTNRNESARDTCTKVGNAILGYANALLAKVESGPNETMTEQNAHNIAAIIFYDVQLQDAMKGLGMADNADLQLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0008649_1021707913300005838MarineHHRHLSDREYVATLPDVRADTVADADISAHEAAREEAAKVKKNPQSALLSSIRTDLEQINKDLSFGVSFSQSSRNEHAKALVTKAGDSILDYATKLIAKVNSASDETLTEQNAHNMAAMIFYDVQVQDAGNALGMTPNADLSLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0070743_1016156613300005941EstuarineFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG*
Ga0070742_1021534313300005942EstuarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRL
Ga0075501_136014713300006355AqueousVTLSTFALLIASSEAAIINKHVKGVTFVQTLPDVRADTVTEADIAAHERARADAAKVKKNPQSALLQSIRGDLEAINFDLSFGVSFSQNNRNNRAKALCTKIGNAIKDYAEKLITTVDKAPDDALTEQNAHNIASMIFYDVQLEDNMKTLGMDEDKDLVLAVNRLKALQKLYLFEQKGGENYLS*
Ga0075487_141957713300006356AqueousKFLTLSAFAMLLANTEAITIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANTDLNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0075487_147706813300006356AqueousKFLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075487_149141513300006356AqueousKFLTIAAMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0075487_151660013300006356AqueousRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATVKADLDQISKDLSFGVSYSQAKRNDHARALCEKVATAILGYADGITAQVEAKTNESMTELNAHNISAFIFYDVQLQEFMNGLGMASNDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075502_158049813300006357AqueousMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075502_164608713300006357AqueousAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075498_126546913300006378AqueousFALLIASSEAAIINKHVKGVTFVQTLPDVRADTVTEADIAAHERARADAAKVKKNPQSALLQSIRGDLEAINFDLSFGVSFSQNNRNNRAKALCTKIGNAIKDYAEKLITTVDKAPDDALTEQNAHNIASMIFYDVQLEDNMKTLGMDEDKDLVLAVNRLKALQKLYLFEQKGGENYLS*
Ga0075494_136257313300006382AqueousTLPDVRADTVSDEDIAAHEAARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG*
Ga0075504_128923113300006383AqueousKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075509_121301613300006390AqueousKMRLSSIFAIALLTNEISAVKVNTLPDVRPDLVADADIAAHEAARAEAAKVKKNPQDALLTSIRADLEQINKDNSFGISFSQKARNDHARELCTKIAGEIKEYTTKLLASVDAKPDETLTEQNAHNISAIVFYEVQLHDYMTALAMPEDADLSLAANRLKSLQKLYLFEQKGGENYLG*
Ga0075509_140917313300006390AqueousMKFLTLFALLVASSEAANINRHNIKGVTFLQTLPDVRADTVTEKDIAAHEKARSEAAKVKKNPQASLLNSIRTDLESVNHDISFGVSFSQNGRNNRARALCTKISNAIKDYANKLITVVEKQPNDALTEQNAHNIASMIFYDVQLEDNMKELGMDADTDLQLAVNRLKSLQKLYLFEQKGGENYLD*
Ga0075507_141230913300006392AqueousMKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075517_130422613300006393AqueousSAIAMLLASTEAASISRHNVKGVTFVQTLPDQRADTVTEKDIAAHEAARAEAAKVKKNPQAALLQSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEENMKELGLDEDKDLVLAVNRLKSLQKLY
Ga0075517_131074913300006393AqueousAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*AKSILVLQEL*
Ga0075517_154632713300006393AqueousKFLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075492_133706313300006394AqueousFLSVATIALCVASSQAVTRHPVRGVTFVQTLPDVRTDSVTEADIAAHEAARADAAKVKKNPQSSLLQSIKADLEQINNDMSFGISFSQSSRNQHAKELCVKIANAVQDYAKKLISTVDQSPNETLTEQNAHNIASMIFYDVQLEDSMKALGMPENNDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075488_101914513300006397AqueousKIMKFLTLSAFAMLLANTEAITIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANTDLNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0075488_144934613300006397AqueousARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0075503_169176313300006400AqueousLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075503_169333313300006400AqueousDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*AKSILVLQEL*
Ga0075506_163360913300006401AqueousKFLTLFALLVASSEAANINRHNIKGVTFLQTLPDVRADTVTEKDIAAHEKARSEAAKVKKNPQASLLNSIRTDLESVNHDISFGVSFSQNGRNNRARALCTKISNAIKDYANKLITVVEKQPNDALTEQNAHNIASMIFYDVQLEDNMKELGMDADTDLQLAVNRLKSLQKLYLFEQKGGENYLD*
Ga0075514_172606813300006403AqueousLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075514_195947013300006403AqueousVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075515_1083608323300006404AqueousDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0075515_1096575113300006404AqueousLLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0075510_1078827523300006405AqueousMKFLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAANIAQMIFFDVQLQDFMTGLGMAASDDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075486_101786013300006425AqueousKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLG*AA*CFSRKKHQIAEK*
Ga0075505_144278313300006571AqueousKFLTLFALLVASSEAANINRHNIKGVTFLQTLPDVRADTVTEKDIAAHEKARSEAAKVKKNPQASLLNSIRTDLESVNHDISFGVSFSQNGRNNRARALCTKISNAIKDYANKLITVVEKQPNDALTEQNAHNIASMIFYDVQLEDNMKELGMDADTDLQLAVNRLK
Ga0075471_1031607813300006641AqueousMKFITLSTFALLIASSEAAIINKHVKGVTFVQTLPDVRADTVTEADIAAHERARADAAKVKKNPQSALLQSIRGDLEAINFDLSFGVSFSQNNRNNRAKALCTKIGNAIKDYAEKLITTVDKAPDDALTEQNAHNIASMIFYDVQLEDNMKTLGMDEDKDLVLAVNRLKALQKLYLFEQKGGENYLS*
Ga0075467_1026528813300006803AqueousMKFLSVATIALCVASSQAVTRHPVRGVTFVQTLPDVRTDSVTEADIAAHEAARADAAKVKKNPQSSLLQSIKADLEQINNDMSFGISFSQSSRNQHAKELCVKIANAVQDYAKKLISTVDQSPNETLTEQNAHNIASMIFYDVQLEDSMKALGMPENNDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075467_1027070523300006803AqueousMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATVKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0075463_1015527523300007236AqueousKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAAAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0102880_106919113300007550EstuarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0102880_112926213300007550EstuarineMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNGTSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGE
Ga0102881_108149113300007551EstuarineMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG*
Ga0102820_111601713300007554EstuarineMKFLPTLALLALVNAVRIETLPDVRPDLVADSDIAAHEAARKEAAKVKKNPQTSFIETIKQDMQEINNDMSFGVSYSQKARNDHAVGLCQKTAASIIQWTGSLINQVNSNTADDKLTEMDAHNIGVAIFYDVQLEDAMKELGMQENQDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0102822_105380913300007558EstuarineMKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0102823_116925113300007692EstuarineMKFLTLSIAMLFASAEAAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENY
Ga0102867_109739713300007716EstuarineMKFLTYCALIAATAAVQRHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKIKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVGDAILGYADGITAQVEAKTNESMTEMNAHNISAMIFYDVQLQEFMNGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0105744_111712713300007863Estuary WaterASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDDLILAVNRLKTLQKLYLFEQKGGENYLG*
Ga0103733_102796223300008930Ice Edge, Mcmurdo Sound, AntarcticaMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103734_103152113300008931Ice Edge, Mcmurdo Sound, AntarcticaFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103739_102029713300008936Ice Edge, Mcmurdo Sound, AntarcticaMKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103740_104201013300008937Ice Edge, Mcmurdo Sound, AntarcticaVTFLSTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103741_105814613300008938Ice Edge, Mcmurdo Sound, AntarcticaIMKFLTIAAMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103741_106375223300008938Ice Edge, Mcmurdo Sound, AntarcticaKFLSLAAIAMLCASAEALNIRTLPDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0104259_101414413300008958Ocean WaterAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0104259_102404713300008958Ocean WaterAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTDRDTCTKVAASILDYANKLIGKVESAATETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0104259_102452213300008958Ocean WaterAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDDLILAVNRLKTLQKLYLFEQKGGENYLG*
Ga0104258_103521223300008993Ocean WaterKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0104258_104455523300008993Ocean WaterMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQTAPDDLILAVNRLKTLQKLYLFEQKGGENYLG*
Ga0104258_111061613300008993Ocean WaterHFSAIAMLFASAEAAQLNSLRHHHRVSDREYIATLPDVRADTVADADIAAHEAAREEAAKVKKNPQMALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMTGKNDLNLAVNRFKS
Ga0102816_116184013300008999EstuarineMKFFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGYLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0102810_108373913300009002EstuarineMKFFTVSAFAMLIATTQSVAISRHSVPGVTFIQTLPDARADSVTEADIAAHETARAEAAKVKKNPQSSLLHTIKTDLETISNDTSFGVSYSQSARNTHAKELCVKISNAIQDYSKKLISTVDKSPNDALTEQNAHNIASMIFYDVQLEDYMKTLGMTENTELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0102810_108520023300009002EstuarineMKFLTISAFALLIASAEAASLGRHPVRGVTFVQTLPDVRADTVTENDIKAHETARAEAAKVKKNPQASLLHSIKTDLEQINNDISFGVSYSQSKRNAHAKELAVKIGNAIQDYAKKLITTVDKSPNESLTEQNAHNIASMIFYDVQLEDSMKELGMSENKELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0103706_1006409713300009022Ocean WaterKFLTSTAVALLLASTEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0103707_1007212213300009025Ocean WaterALISSTEAANLGAMRHRHHPINDEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCTKVGTSILGYANNLIAKVETGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0103707_1018741613300009025Ocean WaterEQRVVPILWDTVKSNVHGKKRSQVVYNAVEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVAQAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0102829_108252623300009026EstuarineMKFLTISAFALLIASAEAASLGRHPVRGVTFVQTLPDVRADTVTENDIKAHETARAEAAKVKQKPQASLLHSIKTDLEQINNDISFGVSYSQSKRNAHAKELAVKIGNAIQDYAKKLITTVDKSPNESLTEQNAHNIASMIFYDVQLEDSMKELGMSENKELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115566_1023216513300009071Pelagic MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115566_1024093013300009071Pelagic MarineMKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0115566_1031174913300009071Pelagic MarinePKPQNPTKMTSIQLIFLDHFSYNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0115566_1062477013300009071Pelagic MarineMKFFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSTKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAANGDLVLAVNRLKSL
Ga0114995_1030624623300009172MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTAMSFGISYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0115551_113966813300009193Pelagic MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0103872_100572023300009263Surface Ocean WaterMKFLTYCALVAAASASTLMRHHHHYPSSLQYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQLEVLTTIKLDLDQISKDLSFGVSYSQQKRNDHARNLCVKVATAIKGYADGITAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMAADNDLILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0103872_102250413300009263Surface Ocean WaterMKFLTLSAIAMLFASAEAAQLNSLRHHRHIYDREYVATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHARELVTKAGNAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQIQDAANALGMAPNGELNLAINRLKSLQKLYLFEQKGGENYLG*
Ga0103873_105412713300009265Surface Ocean WaterAAAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLATVKADLDQISKDLSFGVSYSQAKRNDHARGLVTKVTTAIKGYADGILAQVEAKTNESMTEQNAHNISAMIFYDVQVQEFASGLGMAIPDDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0103827_101198613300009357River WaterADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGASILGYANSLIGRVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0115008_1046717513300009436MarineMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0115008_1048596713300009436MarineMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL*
Ga0115556_122909413300009437Pelagic MarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATVKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDFMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENY
Ga0115556_128492523300009437Pelagic MarineRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115553_127414113300009445Pelagic MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTG
Ga0115571_118281313300009495Pelagic MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0115570_1030541223300009496Pelagic MarineFVSTLPHVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQTKRNDIARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0115572_1030078613300009507Pelagic MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDSMAGLGMSENTELVLAVNRMKSL*
Ga0115567_1047600213300009508Pelagic MarineMKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKAGGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGNSLGMAPNSDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115567_1061161713300009508Pelagic MarineRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115004_1055075023300009526MarineSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0115099_1047102313300009543MarineKFFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115011_1094989513300009593MarineLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTNRNDHARQLCTKVAKAIKDYSAKLLTKVESGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAV
Ga0115103_119590013300009599MarineMKFLTLSAIAMLFASAEAAQLNSLRHHHRVSDREYIATLPDVRADTVADADIAAHEAAREEAAKVKKNPQMALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMTGNNDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_122646913300009599MarineMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115103_122704813300009599MarineFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_130090313300009599MarineKFLSVIAILAATSQAVSITTLPDVRADTVADADIAAHEAARADAAKVKKNPQAALLTSIRADLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_153785513300009599MarineKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115103_168851813300009599MarineMKFLKLSALLVVANAISLTTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQSALLESIRVDLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYSGKLIAKVDTASDETLTEQNAHNIASMVFYDVQVEDAAASLGMEKNADLQLAVNRLKSLQKLYLFEQ
Ga0115102_1044513513300009606MarineKFLTLSAIAMLFASAEAAQLNSLRHHHRVSDREYIATLPDVRADTVADADIAAHEAAREEAAKVKKNPQMALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMTGNNDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115102_1059877413300009606MarineSSEAASINRHKHIKGVTFVQTLPDARADTVTEKDIAAHETARAEAAKVKKNPQAGLLTSIRTDLETINFDMSFGVSFSQNGRNNRARALTTKIGNAIKDYSNKLIGVVDKSPNDALTEQNAHNIASMIFYDVQLEDAMKELGMEEDHELQLAVNRLKSLQKLYLFEQKGGENYLS*
Ga0115102_1083887613300009606MarineMKFTTLIAVVALLGVSARHHHVRNYDYIATLPDVRADTVADADIAAHETARADAAKVKKNPQSSLLATVRQDLEQINNDMSFGVSFSQSKRNLHAQELCVKVSNAIQDYTKALLTTVEAQSEESLTEQNAHNIAAMIFYDVQLEDNMKSLGQTPSVELVQAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115102_1093727813300009606MarineMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0115100_1068441213300009608MarineHGHEFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115104_1004186313300009677MarineLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0115104_1013734113300009677MarineKYTAAALLAVALLVSDTNAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMHGLGMPENGELVLSMNRMKSLQKLYLFEQKGGENYLG*
Ga0115104_1017469413300009677MarineHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMASDDELVLAVNRLKSL*
Ga0115104_1019910113300009677MarineLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115104_1021025313300009677MarineTVVLAALLFSSTEAVTTLKKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVISYDVQLQDNMSGLGMSSDEELVLAVNRLKSL*
Ga0115104_1043635613300009677MarineSTVVALLIASSEATQISAMRHHNHYPSHYEYIATLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLG*
Ga0115104_1063179413300009677MarineVILAALFLSSAQAVQSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLQSIKADLEAINADLSFGISFSQTKRNDHARETSLKVAKAIKDYADKLLNKVEAGPNETLTEQNAHNIAAVIFYDVQLQDDMAGLGMAADEDLVLAVNRLKS
Ga0115104_1090916613300009677MarineTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0115104_1094992213300009677MarineMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLSKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDDELVLAVNRLKSL*
Ga0115104_1095213313300009677MarineKIMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL*
Ga0115104_1118239513300009677MarineKFLTLAMLFASTEAAKLNRHHPYDRQYISTLPDVRADTVADADIAAHEAARAEAAKVKKNPQEPLLTSIRADLEQINKDLSFGVSFSQKSRNDAARDLVEKAGKSILDYATKLIAKVDSNSDETLTEQNAHNIAAMIFYDVQVQDAANALGMPANSDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115104_1121190313300009677MarineLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSL
Ga0115105_1041868013300009679MarineLTLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115105_1059086213300009679MarineLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTNRNDHARQLCTKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115105_1083777813300009679MarineVRPATPTEADIAAHDAARATAAKVKKNPQQNLLNSMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115105_1108041013300009679MarineKFLTYIALIASTAAVSRRHVPDVTFVETLPDVRPDLVTEGEIAAKEAARSESAKVKKNPQAALLASIRADLEAVNNDMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0115105_1141328013300009679MarineHEFISTLPDVRPDTVTEEDIAAHEAARNEAAKVKKNPQAALLASIKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVATAIEGYASAILAKIESGPNETLTEQNAHNIAAVIFYDVQLGDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115000_1044986113300009705MarineMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSSSILDYANKLIDKVESAPTETLTEQNAHNIASVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL*
Ga0123383_10877413300009719MarineLIAAAAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATVKADLDQISKDLSFGVSYSQAKRNDHARGLVTKVTTAIKGYADGILAQVEAKTNESMTEQNAHNISAMIFYDVQVQEFASGLGMAIPDDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0123377_108413113300009735MarineYGHELVATLPDVRADTVADADIAAHEKARAEAAKVKKNPQASLLNSIKTDLEQVNKDLSFGVSFSQGKRNNHAKELCTKVSNGIVGYAKKLIAKTESNPNETLTEQNAHNIAAMIFYDVQLEDAMKSLGMKADEERGLYVNRLKSLQKLYLFEQKGGENYLG*
Ga0115001_1027614413300009785MarineMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL*
Ga0115001_1036356813300009785MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL*
Ga0115001_1054003813300009785MarineTMGYNKLKIIMKFLTYIALVASTAAVSRRHVPDVTFVETLPDVRPDLVTEGEIAAKEGARSTAATVKKNPQAALLASIKADLEQVNNDMSFGISYSQNKRNDHGQALVTKVSNAIVDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQAEDAGAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0115012_1062883213300009790MarineMKFLTSAAVALLIASSEATQISAMRHHNHYPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQSAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGEN
Ga0115012_1120336013300009790MarineHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDGMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0129336_1029609313300010370Freshwater To Marine Saline GradientMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNGTSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG*
Ga0133547_1197381313300010883MarineMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138316_1013555013300010981MarineELVSTLPDVRPDTVADSDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDAGRDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG*
Ga0138316_1054988013300010981MarineHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVSKAIKDYTSKLLSKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDEELVLAVNRLKSL*
Ga0138316_1147609513300010981MarineTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL*
Ga0138316_1160001013300010981MarineRNMVIVPEMIGSIVAVKFLTSTVVALLIASSEATQISAMRHHNHYPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLG*
Ga0138326_1004106813300010985MarineLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADDELVLAVNRLKSLQKLYL
Ga0138326_1116948913300010985MarineLLFSSAEAAQLTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL*
Ga0138326_1124718213300010985MarineKFTVVLAALLFSSTEAVTTLKKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL*
Ga0138326_1124867613300010985MarineKFTVVLAALLISSTEAVTSLKRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVSKAIKDYTSKLLSKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDEELVLAVNRLKSL*
Ga0138326_1128998913300010985MarineVVLAALFLSSAEAAHLQSLRKHHRRPTGHEYLSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADEDLVLAVNRLKSL*
Ga0138326_1136785413300010985MarineRNMVIVPEMIGSIVAVKFLTSTVVALLIASSEATQISAMRHHNHYPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLSTVEGGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDL
Ga0138326_1211730313300010985MarineVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLK
Ga0138327_1183310313300010986MarineVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL*
Ga0138324_1023350813300010987MarineKIMKFTVVIAALLFSSAEAVTTLKKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVSKAIKDYTSKLLSKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDEELVLAVNRLKSL*
Ga0138324_1029119813300010987MarineLIKLMKFQVILAALFLSSAQAVQSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLQSIKADLEAINADLSFGISFSQTKRNDHARETCLKVAKAIKDYADKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGADEDLVLAVNRLKSL*
Ga0138324_1034014913300010987MarineSEATQLSAMRHHNHYPSDYEYISTLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0138324_1053715013300010987MarineRADTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0138324_1059094013300010987MarineKIMKFLALAALLFTVEGAQLGSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEVSKVKKNPQSALLQTIKADLETVNADLSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMGVDADLVLAVNRLKSLQKLYLFEQK
Ga0136599_102185413300012030Saline LakePKTPKPHESDSLKLFIIIKLIMKFLSLSAIAMLVASTDAASIRRHHNIKGVTFIQTLPDQRADTVTEKDIAAHETARADAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTVKIANAIKDYSNKLISTVDKSPDEALTEQNAHNIASMIFYDVQLEENMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENYLS*
Ga0136600_105374313300012036Saline LakePQNPKTPKPHESDSLKLFIIIKLIMKFLSLSAIAMLVASTDAASIRRHHNIKGVTFIQTLPDQRADTVTEKDIAAHETARADAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTVKIANAIKDYSNKLISTVDKSPDEALTEQNAHNIASMIFYDVQLEENMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENYLS*
Ga0123369_100656413300012370MarinePDTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGVSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0138265_111277913300012408Polar MarineMKFLTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138258_167283213300012413Polar MarineMKYFNVASILAIALLINDTSAINVSTLPDVRADTVSDEDIAAHESARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVATSIEGYASNLITTVEAGPNETMTEQNAHNIAAMILYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0138264_117148513300012414Polar MarineCCGLFLTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138263_180528113300012415Polar MarineKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTFTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138262_110134813300012417Polar MarineKFFNVASILAVALLINDTSAIKVSTLPDVRADTVSDEDIAAHESARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSVMDYASNLLTTTEAGPEETLTEQNAANLASIIFYDVQLQDSMKGLGMPENGELVLAVNRMKSM*
Ga0138261_103092713300012418Polar MarineTTLPDVRADTVADADIAAHEAARVEAAKVKKNPQTALLTSIRADLEQINKDLSFGISFSQGKRNDHAKALVSKVSTAILDYAGKLISKVDGASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMTANGDLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0138261_122070313300012418Polar MarineLLINDTSAIKVSTLPDVRADTVSDEDIAAHESARADAAKVLKNPQSQLLASVKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSVMDYASNLLTTTEAGPEETLTEQNAANLASVIFYDVQLQDSMKGLGMPENGELVLAVNRMKSMQKLYLFEQKGGENYLG*
Ga0138260_1034499513300012419Polar MarineKIMKFFNVASILAIALLINDTSAIKVSTLPDVRADTVSDEDIAAHESARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSVMDYASNLLTTTEAGPEETLTEQNAANLASIIFYDVQLQDSMKGLGMPENGELVLAVNRMKSMQKLYLFEQKGGENYLG*
Ga0129329_104665613300012470AqueousEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVL
Ga0129334_106407213300012471AqueousKISMKFITLGVLALLGATEAAKMERHIKGVTFVQTLPDVRADTVTEADIAAHERARAEAAKVKKNPQAGLLQSIRTDLESINYDLSFGVSFSQNARNNRARALCTKIANAIKDYSSKLITTVDKAPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKS
Ga0129347_108382113300012504AqueousLHRDRQARTLLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129347_112856413300012504AqueousVATLPDVRPDTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGVSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0129347_129012613300012504AqueousATGRLGWIVAFCVVRTAGQGMAPGAVPAQGTTDSELKRTSLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0129325_119247113300012516AqueousSDEDIAAHEAARAEAAKVKKNPQLDVLLTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQGYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMASDDALILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0129349_101888213300012518AqueousVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0129349_104148513300012518AqueousASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0129349_108402413300012518AqueousKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129349_129828713300012518AqueousMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0129344_100877613300012520AqueousIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0129344_100938913300012520AqueousMKFLTYCALIAAAAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATVKADLDQISKDLSFGVSYSQAKRNDHARGLVTKVTTAIKGYADGILAQVEAKTNESMTEQNAHNISAMIFYDVQVQEFASGLGMAIPDDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0129344_136437513300012520AqueousKFLTYCALIAAAAATSRHHHHPHSVEYVSTLPDVRADTVSDEEIAAHEAARAEAAKVKKNPQSELIATIKADLDQISKDLSFGVSYSQQKRNDHARDLCNKVASAILGYADGILTQVEAKTSESMTEMNAHNIAAMIFYDVQLQEFMSGLGMAQNDQLILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0129326_129963213300012522AqueousLTYCALVAAASASTLARHHHHPSSLQYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQLEVLTTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQGYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMASDDALILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0129350_109255013300012523AqueousMKFLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENY
Ga0129350_135763013300012523AqueousTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0129350_137664113300012523AqueousMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129353_135673313300012525AqueousAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129353_159666813300012525AqueousFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELLTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0129352_1034949613300012528AqueousLLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129352_1070157013300012528AqueousMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0138267_125640813300012767Polar MarineTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0163179_1194824313300012953SeawaterVRPATPTEADIAAHEAARATAAKVKKNPQQNLLNSMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEAAELVLAVNRLKSLQKLYLFEQKGGENYLG*
Ga0163111_1139367813300012954Surface SeawaterMKYTAILAVALLVSNASAFRLETLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIMDYSSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0163111_1193212413300012954Surface SeawaterMKFFNVASILAIALLVNDSSAHRLSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASIIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKL
Ga0129335_111363913300012962AqueousKFLTYCALIAAAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKADLDQISKDLSFGVSYSQAKRNDHARGLCLKVETAIKGYADGILAQVEAKTNESMTEMNAHNISAMIFYDVQVQEFAAGLGMAIADDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0129335_114316913300012962AqueousMKFITLGVLALLGATEAAKMERHIKGVTFVQTLPDVRADTVTEADIAAHERARAEAAKVKKNPQAGLLQSIRTDLESINYDLSFGVSFSQNARNNRARALCTKIANAIKDYSSKLITTVDKAPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQRGGENYLG*
Ga0129340_104083713300012963AqueousTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG*
Ga0129340_111805413300012963AqueousLAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGVSYSQKARNEHARGLVNDTAAALLAYANAIIAKTESGANESLTEQNAHNIAKAIFYDVQLQDAAAGLGMAENTALSLSINRLKSLQKLYLFEQKGGENYLG
Ga0129340_115209713300012963AqueousIMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIRADLDQISKDLSFGVSYSQAKRNDHARDLCNKVADAILGYADGITAQVEAKTNESMTEMNAHNISAMIFYDVQLQEFMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0129340_115299413300012963AqueousIMKFLTYCALIAAAAATSRHHHHPHSVEYVSTLPDVRADTVSDEEIAAHEAARAEAAKVKKNPQSELIATIKADLDQISKDLSFGVSYSQQKRNDHARDLCNKVASAILGYADGILTQVEAKTSESMTEMNAHNIAAMIFYDVQLQEFMSGLGMAQNDQLILAVNRLKSLQKLYLFEQKGGENYLS*
Ga0129340_136718013300012963AqueousMKFLTSAAVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG*
Ga0129346_111777913300012965AqueousLATLAVAMLVSESAAHRHHHRRNYELVSTLPDVRDDTVADADIAAHEAARAEAAKVKKNPQESLFTTVSANLDQINKDMSFGVSYSQKARNEHARGLVNDTAAALLAYANAIIAKTESGANESLTEQNAHNIAKAIFYDVQLQDAAAGLGMAENTALSLSINRLKSLQKLYLFEQKGGENYLG*
Ga0129346_119736013300012965AqueousVATLPDVRPDTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGASILGYANNLIAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0129346_123132713300012965AqueousKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKADLDQISKDLSFGVSYSQAKRNDHARDLCNKVAAAILGYADGITAQVEAKTNESMTEMNAHNISAMIFYDVQLQEFMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG*
Ga0129343_113151913300012967AqueousATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATVKADLDQISKDLSFGVSYSQAKRNDHARGLVTKVTTAIKGYADGILAQVEAKTNESMTEQNAHNISAMIFYDVQVQEFASGLGMAIPDDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0129337_125950313300012968AqueousKFITLGVLALLGATEAAKMERHIKGVTFVQTLPDVRADTVTEADIAAHERARAEAAKVKKNPQAGLLQSIRTDLESINYDLSFGVSFSQNARNNRARALCTKIANAIKDYSSKLITTVDKAPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQRGGENYLG*
Ga0129337_128734313300012968AqueousKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNGTSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG*
Ga0129337_132317313300012968AqueousLTYCALIAAAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKADLDQISKDLSFGVSYSQAKRNDHARGLCLKVETAIKGYADGILAQVEAKTNESMTEMNAHNISAMIFYDVQVQEFAAGLGMAIADDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0129338_144551613300012970AqueousIMKFLTYCALIAAAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKADLDQISKDLSFGVSYSQAKRNDHARGLCLKVETAIKGYADGILAQVEAKTNESMTEMNAHNISAMIFYDVQVQEFAAGLGMAIADDYNLAINRLKTLQKLYLFEQKGGENYLA*
Ga0171652_108430113300013110MarineVRPDTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCTKVGGSILDYSNNLIARVESGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG*
Ga0182056_124956713300016729Salt MarshKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0182094_127772013300016731Salt MarshTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182057_100338413300016732Salt MarshKFLTLSIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYATKLIAKVNSASDETLTEQNAHNIAAMIFYNVQLQDAGNALGMAPNADLNLAVNRLKSLQKL
Ga0182074_106549813300016735Salt MarshKISMKFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182096_118941413300016740Salt MarshMKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLGXAKSILVLQEL
Ga0182079_170439813300016741Salt MarshFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKS
Ga0182043_111391113300016748Salt MarshLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQLDVLLTIKLDLDQISKDLSFGVSYSQQKRNDHARTLCTKVAAAIQGYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMASDDALILAVNRLKSLQKLYLFEQKGGENYLS
Ga0182072_145881913300016754Salt MarshKFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQKGG
Ga0182072_153361013300016754Salt MarshIAAHEAARAEAAKVKKNPQDDLFKSVKANLEQINKDMSFGVSYSQTARNEHARGLATQTAAALNSYADAIIAKTESGPNESLTEQNAHNIAKAIFYDVQLQDAMKGLGMADDAGLVLNFNRLKSLQKLYLFEQKGGENYLG
Ga0182091_105554313300016766Salt MarshSSIFAIALLTNEISAVKVNTLPDVRPDLVADADIAAHEAARAEAAKVKKNPQDALLTSIRADLEQINKDNSFGISFSQKARNDHARELCTKIAGEIKEYTTKLLASVDAKPDETLTEQNAHNISAIVFYEVQLHDYMTALAMPEDADLSLAANRLKSLQKLYLFEQKGGENYLG
Ga0182091_117447913300016766Salt MarshHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATVKADLDQISKDLSFGVSYSQAKRNDHARALCEKVATAILGYADGITAQVEAKTNESMTELNAHNISAFIFYDVQLQEFMNGLGMASNDALILAVNRLKSLQKLYLFEQKGGENYLG
Ga0182082_124930013300016771Salt MarshIATLAMVLLVSNSDAATLSALRRHHHHPHTMEYVATLPDVRPETPTEEDIAAHEKARADAAKVKKNPQATLLASIKTDLEAINTDMSFGVSYSQSKRNDNARALCTKVAGSIKTYTNALIAKVNGQAEGALTEQNAHNIAAVIFYDVQLEDAMKGLGMAEDNDLVLAVNRLKSLQKLYLFEQKG
Ga0181403_105147513300017710SeawaterMKFLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181423_125665913300017781SeawaterDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0181380_123848923300017782SeawaterVSNASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181565_1061158713300017818Salt MarshTSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181577_1048800013300017951Salt MarshMKFLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSSRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181571_1062279613300017957Salt MarshMKFLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0181582_1054707613300017958Salt MarshMKFIATLAMVLLVSNSDAATLSALRRHHHHPHTMEYVATLPDVRPETPTEEDIAAHEKARADAAKVKKNPQATLLASIKTDLEAINTDMSFGVSYSQSKRNDNARALCTKVAGSIKTYTNALIAKVNGQAEGALTEQNAHNIAAVIFYDVQLEDA
Ga0181589_1073507113300017964Salt MarshMKFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLK
Ga0181572_1094483913300018049Salt MarshVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSSRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQK
Ga0181567_1045306913300018418Salt MarshVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0181566_1044669513300018426Salt MarshMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0192960_10281813300018515MarineMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193022_10206613300018538MarineLTSAAVALLIASSEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVAQAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0188826_11213913300018565Freshwater LakeKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0188858_10748613300018567Freshwater LakeHEFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLISKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0188834_101910913300018599Freshwater LakeALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDFMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193133_102345913300018617MarineGAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193204_101312613300018618MarinePHHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0188877_101304013300018619Freshwater LakeMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLGXAQSGFVPKL
Ga0188862_101077613300018622Freshwater LakePAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0192842_102369813300018625MarineSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192842_103588013300018625MarineEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193355_102089513300018628MarineEFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNETGRDLCSKVATAILDYSNKLISKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192846_102238413300018655MarineRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193122_106251513300018661MarineKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCSKVGASILDYATKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0188882_101898713300018665Freshwater LakeAAILKRHNVPGVTFLQTHPDVRADTVADADIAAHEAARADAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSSDNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0193166_101091513300018674MarinePDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193206_101885613300018681MarineMKFLTLAMLFASTEAAKLNRHHPYDRQYISTLPDVRADTVADADIAAHEAARAEAAKVKKNPQEPLLTSIRADLEQINKDLSFGVSFSQKSRNDDARALVTKAGASILDYATKLIAKVDSNSDETLTEQNAHNIAAMIFYDVQVQDAANALGMPANADLNLAVNRLKSLQKLYLFEQKGGENYLGXAMSIANMQ
Ga0192983_103099313300018684MarineMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0192944_102386413300018692MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192944_102432013300018692MarineMKFFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXTXLSFVLEHECGVAAIT
Ga0192944_102943613300018692MarineASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0192944_103257213300018692MarineMLLASAEATQLNSLRHHRQIYDRQYIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQTLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192944_103519013300018692MarineDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYASNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0192944_103744913300018692MarineMGNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAGKTKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193405_103413813300018701MarineKFLTSTAVALLIASSSATSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193405_103834313300018701MarineLPDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLATIKADLEAINTNMSFGVSYSQTKRNDSARDLCTKVGSSILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193405_104188313300018701MarineAARAEAAKVKKNPQSALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVAAAIQDYATKLIAKVEGGANETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLDINRLKSLQKLYLFEQKGGENYLG
Ga0193324_104176413300018716MarineRPDTISDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193391_102064513300018724MarineKFLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVATLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193391_102776113300018724MarineLPDVRADTVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193517_103702513300018725MarineLNSLRRHHRPHGRQYLSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEAINQDLSFGISFSQTKRNDHARELCQKVAKAIEDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMPSDAKLVLSVNRLKSLQKLYLFEQKGGENYLG
Ga0193517_107145513300018725MarineTVADADIAAHEAARAEAAKVKKNPQTALLASIKADLESINVNLSFGVSYSQTKRNENARDTCTKVANAILGYANALIAKVESGPNETLTEQNAHNVAAIIFYDVQLQDAMAGLGMAENADLQLAINRLKSLQKLYLFEQKGGENYLG
Ga0192967_103552213300018730MarineMKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0192967_105619213300018730MarineLPDVRADTVADADIAAHETAREEAAKVKKNPQQSLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193381_105237113300018732MarineVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193544_101741113300018735MarineMKFLTSTAVAPLIASSSATSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193544_102240213300018735MarineHHHGHEFVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193138_102348513300018742MarineKFLTSTAVALLLASTEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193138_103078513300018742MarineAAHEAARATAAKVKKNPQQSLLNSMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEQAELVLAVNRLKSLQKLYLFEQKGGENYLGXAPNVHPLHTAXRE
Ga0193000_103989023300018745MarineVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193000_103989123300018745MarineVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193392_103230613300018749MarineLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193392_104402513300018749MarineLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192883_103623613300018759MarineKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192827_108532913300018763MarineAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGTSILDYATKLIAKVESGANETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0193031_103191413300018765MarineMKFLTSTVVALLVASSEATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193031_103273313300018765MarineMKYTALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSMMDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193031_104871313300018765MarineDADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGGDADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193031_106144913300018765MarineHHHGHEFVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNNDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193031_106840813300018765MarineHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0193031_107879813300018765MarineDIAAHEAARAEAAKVKKNPQTALLASIKADLESINVNLSFGVSYSQTKRNENARDTCTKVGNAILGYANALIAKVESGPNETLTEQNAHNVAAIIFYDVQLQDAMAGLGMAENADLQLAINRLKSLQKLYLFEQKGGENYLG
Ga0193031_108368613300018765MarineHHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193031_109382713300018765MarineAVTTLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL
Ga0193181_104877913300018766MarineRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193181_106927513300018766MarineVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDNARDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0193503_104340613300018768MarineEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193396_105542913300018773MarineADTVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193407_104226713300018776MarineHHYEYVSTLPDVRADTVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193149_103090113300018779MarineAVAVLISSSEAANLNALRRHHHPSHHEFVSTLPDVRPDTVAEEDIAAHEAARSEAAKVKKNPQAALLSSIKTDLEQINKDMSFGVSFSQTKRNDHARELCTKVGSAIEDYTSKLLAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMKGLGMPEDGELVLDMNRMKSLQKLYLFEQKGGENYLG
Ga0193149_104349113300018779MarineHHHHGHELVATLPDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLSTKVAGAILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193380_106046913300018781MarineESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192950_103823213300018791MarineLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0192824_109281713300018801MarineAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193053_104397313300018823MarineANTSAFRLETLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193053_107295213300018823MarineVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193048_103577913300018825MarineATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193394_106098123300018826MarineAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193394_107699713300018826MarineHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192949_107876713300018831MarineTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0194240_100714913300018832MarineMKFLTYTFAVAALVASADAATLSSLRRHRHHPSHHEFISTLPDVRPDTVTEEDIAAHEAARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEEYSSKLLAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMKGLGMPSNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0194240_100734513300018832MarineMKFFTYTLAVAALVSSTDAATISSLRKHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARAEAAKVKKNPQAALLASLKTDLEQINKDMSFGISFSQSKRNDHARELCTKVGAAIEDYATKLLGKIESGPNETLTEQNEHNISSVIFYDVQLQDAMKGLGMPANDGLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0194240_101572513300018832MarineHHEFVSTLPDVRPDTVTEEDIAAHEAARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNAHNIAAVIFYDVQLQDAMKGLGMPSNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0194240_102342913300018832MarineGHELVATLPDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLATIKADLEAINTNMSFGVSYSQTKRNDSARDLCTKVGSSILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192870_105233513300018836MarineLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193302_104009713300018838MarineKFLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193302_104054013300018838MarineLTSTAVALLIASSEATQLSAMRHHNHYPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193219_103139113300018842MarineIMKFLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVATLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193219_104122713300018842MarineFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVINGGRNSLTVSLXNQXE
Ga0193219_104568623300018842MarineFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193219_105982213300018842MarineREYVATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHARELVTKAGNAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQIQDAANALGMAPNADLNLAINRLKSLQKLYLFEQKGGETISAQQYHSCDSRTIDESVKNNIILT
Ga0193253_106723913300018846MarineMKFFTYTIAVAALVASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0193253_107460413300018846MarineMKFFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193475_103751413300018855MarinePATPTEADIAAHEAARATAAKVKKNPQQNLLQSMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAIQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEAAELVLAVNRLKSLQKLYLFEQKGGENYLGXAPNVHPLHTAXRE
Ga0193475_108209913300018855MarineAHEAARAEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCSKVGASILDYATKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193308_106135513300018862MarineGHEFVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTGRDLCNKVATAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192978_104495213300018871MarineNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192978_107177013300018871MarineEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXVEEQLMNXAT
Ga0192977_104880713300018874MarineMKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193337_103875913300018880MarineRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193185_107457713300018886MarineYEYISTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193185_107519113300018886MarineYEYISTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193028_109053813300018905MarinePDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNNDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193028_112151313300018905MarineVVALLVASSEATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLK
Ga0192868_1003782513300018913MarineFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHESARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLGXAMNFLXCKNYKGISEKY
Ga0192868_1005497413300018913MarineMKFLTSTVVALLIASSEATQISAMRHHNHYPSHYEYIATLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193420_1006978913300018922MarineAAHEVARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192989_1008299913300018926MarineIKFFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192989_1012138113300018926MarineAEATQLNSLRHHRHIYDNQYIATLPDVRADTVADADIVAHEAAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKDLVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANSDLNLAVNRLKSLQKLYLFEQKGGENYLGXVTPFLXRKNYKRISEKYNSDXLEVTAAPATVDTARLDN
Ga0192820_1007326213300018932MarineTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193426_1013802013300018942MarineRPDTVSDADIAAHEAARSEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193379_1010461613300018955MarineKFLTSTAVALLIASSSATSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHESARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193379_1013642513300018955MarineLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193379_1013643013300018955MarineLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193178_1002152913300018967MarineKFLTSAAVALLIASSEATQLSAMRHHSHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193178_1006031513300018967MarineRAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDNARDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0192894_1021390413300018968MarineMKFFKQVILAALFLSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTKRNDHARELCLKVAKAIKDYSGKLLTKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMGGLGMGEDAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192873_1027523113300018974MarineMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINGDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL
Ga0193254_1007350513300018976MarineKFFTYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193353_1015597413300018977MarineVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGGDADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193353_1016916113300018977MarineVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMASDDELVLAVNRLKSL
Ga0193353_1019351213300018977MarineADTVADADIAAHEAARAEAAKVKKNPQSALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGAAVLDYANKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSELVLAINRLKSLQKLYLFEQKGGENYLG
Ga0192961_1009143813300018980MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192961_1010705613300018980MarineMKFFTYTIAVAALVASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0192961_1011014413300018980MarineMKLFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192961_1011072713300018980MarineLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192961_1011632513300018980MarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARSEAAKIKKNPQAELLATIKADLDQISKDLSFGVSYSQEKRNDHARALCTKVATAINGYADGITAQVEANTNESMTEMNAHNISAMIFYDVQVQEFMNGLGMAADNTLILAVNRLKSLQKLYLFEQKGGENYLG
Ga0192961_1012596213300018980MarineMKFLTLSAILFATAEATQLNSLRHHRHIYDNQYIATLPDVRADTVADADIVAHEAAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKDLVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANSDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192961_1013035213300018980MarineMKFLTLIALFATAEATQLNSLRHHRHIYDRQYIATLPDVRADTVADADIDAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKDLVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192961_1017048813300018980MarineHHHHGHEFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDTGRDLCNKVSTAILDYSNKLIGKVETGPNEILTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192947_1012167413300018982MarineMKLLSLSVFALLVASSEAANISRHRVKGVTFIQTLPDVRADTVTEKDIAAHETARSDAAKVKKNPQAALLQSIKTDLESINNDLSFGVSFSQNTRNNRARAIATKIGNAVKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEEQMKELQMDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0192947_1013102913300018982MarineTWGYNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAGKTKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0192947_1013595613300018982MarineMKFLSIAAIAMLCASTQAISITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADVEQINKDLSFGVSFSQTARNDHAKELVTKASTAILGYANALIAKVDSASDETLTEQNAHNISAMIFYDVQVNDASNALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0192947_1015712513300018982MarineMKFLTLSAIAMLLASTEATQLNSLRHHRQIYDRQYIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQTLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192947_1016790513300018982MarineMGTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADVEQINKDLSFGVSFSQTARNDHAKELVTKASTAILGYANALIAKVDSASDETLTEQNAHNISAMIFYDVQVNDASNALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0192947_1016943713300018982MarineTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYASNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192947_1017028313300018982MarinePQYRSFVSTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHAKELVTKAGTAILGYANALIAKVDSASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLG
Ga0192947_1022948013300018982MarineIAAHESARAEAAKVKKNPQSALLESIRTDLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAAKLVAKVDTASDETLTEQNAHNIAAMVFYDVQVEDAAASLGMEKNGDLQLAVNRLKSLQKLYLFE
Ga0192947_1023710613300018982MarineKFLSVIAILAATSQAVSITTLPDVRADTVADADIAAHEAARADAAKVKKNPQAALLTSIRTDLEQINKDLSFGVSFSQGKRNDHAKELVSKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAGAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193030_1009951713300018989MarineMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0193030_1010194423300018989MarineVVLAALLFSSAEAVTTLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL
Ga0193030_1011046113300018989MarineEAAQLTSLRRHHRHPRGHEFVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKIAKAIKDYTSKLLSKVEAAPNEVLTEQNAHNIAAVIFYDV
Ga0193030_1011417813300018989MarineMKFLALAALLFTVEGAQLGSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMSGLGMGGDADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193030_1011700213300018989MarineMKFLTSAAVALLIASSEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVRWESXRLILEVELLTYLRTWKNSRHKQDLARPPNRQQLLIQNS
Ga0193030_1012102313300018989MarineEAAQLTSLRRHHRHPRGHEFVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLSKVEAAPNEVLTEQNAHNIAAVIFYDV
Ga0193030_1012483913300018989MarineMKFTVVLAALLFSSAEAAQLNALRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINGDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL
Ga0193030_1013032513300018989MarineMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHESARSEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193030_1014115813300018989MarineHHREFVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQAIKADLETINADLSFGISFSQTKRNDHARETCLKVAKSIKDYSDKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAVLGMAADEDLVLAVNRLKSL
Ga0193030_1015726013300018989MarineHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDEELVLAVNRLKSL
Ga0193030_1016461213300018989MarinePSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193030_1016987513300018989MarineLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGADDELVLAVNRLKSL
Ga0193030_1017947213300018989MarineRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMASDDELVLAVNRLKSL
Ga0193030_1021611613300018989MarineASILAIALLVNDSSAHRLSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASIIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0193030_1022025513300018989MarineKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASVLDYATKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193030_1022384423300018989MarineVRSDTVADADIAAHEAARAEAAKVKKNPQTALLASIKADLEAINTQMSFGVSYSQTKRNENARDLCTKVANSILGYGNALIAKVESGPNETLTEQNAHNVAATIFYDVQLQDAMAGLGMAENDDLKLTVNRLKSLQKLYLFEQKGGENYLG
Ga0193030_1026370013300018989MarineHHGHQYIQTLPDVRSDTVADADIAAHEAARAEAAKVKKNPQTALLASIKADLESINVNLSFGVSYSQTKRNENARDTCTKVGNAILGYANALIAKVESGPNETLTEQNAHNVAAIIFYDVQLQDAMAGLGMAENADLQLAINRLKSLQKLYLFEQKGGENYLG
Ga0193257_1016760513300018997MarineKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193034_1011958213300019001MarineTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193034_1012818013300019001MarineDTVSDEDIAAHEAARAEAAKTLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192880_1007776613300019009MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192880_1011921913300019009MarineKEAALVKKNPQTALIDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLGXAHCCFFXKSILRNEMMAQASTT
Ga0193044_1017636013300019010MarineIAAHEAARAEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPEDGELVLAINRMKSLQKLYLFEQKGGENYLGXMMIEDXKILANLKDEKLMRVGYKYQKXIKTLVGFA
Ga0193044_1018344213300019010MarineHHPHHVELVSTLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192982_1014445313300019021MarineTWGIIKILIMKLLSTIALLVASSEAANISRHNIKGVTFVQTLPDVRADTVTEKDIAAHEASRADAAKVKKNPQSALLTSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKIANAVKDYANKLIGTVDKSPNDALTEQNAHNIASMIFYDVQLEDNMRELGLDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0192982_1014598213300019021MarineVIAALLFSSAQAAQLTSLRRHHAHRPHGHAYVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETVQKVSKAIKDYTSKLLAKIETGPNEVLTEQNAHNIAAVIFYDVQL
Ga0192982_1014834813300019021MarineMKYTIAILALALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARAEASKVTKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELCTKVSGSIQDYCSALLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAIKGLGMPE
Ga0192982_1017008913300019021MarineMKFLTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLGXEIPFLVMQEL
Ga0192951_1019504913300019022MarineAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193545_1007651013300019025MarineMKFLTSAAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193545_1012003713300019025MarineRATLPDVRPDTVSDADIAAHEAARSEAAKVKKNPQAALLGSIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGASILGYSNSLIAKVESGPSETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192909_1004979513300019027MarineMKYQLIIAALFASAASGAQLNSLRRHHHPRHREFVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLQSIKADLEAINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSDKLLKKVEAGPNETLTEQNAHNMAAIIFYDVQLQDNMAGLGMAADEDLVLAVNRLKSLQKLYLFEQKGGENYLGXSASAVEKSQXVNNYDAISSFSTHLEPEHSSRVPRYRYAHDLDDDPR
Ga0193516_1012739413300019031MarineLNSLRRHHRPHGRQYLSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEGINQDLSFGISFSQTKRNDHARELCQKVAKAIIDYSDKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMASDAKLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193516_1012921713300019031MarineTWGDNLIINKIMKFTVVIAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDEELVLAVNRLKSL
Ga0193516_1013631713300019031MarineMKFLTLSIAMLFASVEGAQLSSLRRHHRHSFDREYVATLPDVRADTVADADIEAHEAARAEAAKVKKNPQSALLTSIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYATKLIAKVNSGSDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193516_1013638613300019031MarineMLFASVEGAQLNSLRRHHRHLHDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQSALLTSIRADLEQINKDLSFGVSFSQSSRNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193516_1030751713300019031MarineDTVSEADIAAHEAARSEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGASILDYANKLIGKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192869_1016114413300019032MarineMGKIINKIMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINGDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0192869_1016116513300019032MarineMGINKIMKFTVVLAALLFSSTEAVTTLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0192869_1018822713300019032MarineMKFLTSTVVALLIASSEATQISAMRHHNHYPSHYEYIATLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192869_1021678213300019032MarineMKFLTLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192869_1022653413300019032MarineMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEQINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL
Ga0192869_1024332213300019032MarineHGEFYIPLIMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0192869_1024588313300019032MarineEAVTTLKKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0192869_1027876313300019032MarineLPLFRIRADTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLSTKVAGAILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMSGLGMSENSELVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192869_1029219223300019032MarineTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192869_1030383713300019032MarineVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYSNNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192869_1032805213300019032MarineTWADIAAHESARAEAAKVKKNPQAALLQTIKADLEGINSDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL
Ga0192869_1049812613300019032MarineSTLPDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGASVLDYATKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193037_1014018113300019033MarineLQSLRKHHRHPYGHEYLSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLQTIKADLETINGDLSFGISFSQTKRNDHARELCLKVAKAIKDYSNKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMASDGDLVLAVNRLKSL
Ga0193037_1022911713300019033MarineYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYTSKLLGKVEAAPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMAGDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193037_1036112013300019033MarineADTVADADIEAHEAARAEAAKVKKNPQSALLTSIRTDLEQINKDLSFGVSFSQSARNEHAKELVTKAGNGILDYATKLIAKVNSASDETLTEQNAHNIAAMIFYDVQVQDAANALGMAPNTELNLAVNRLKSLQKLYLFE
Ga0192945_1011082513300019036MarineMKFLTSTAVTLLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192945_1011273913300019036MarineMKFFTYTIDAAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192945_1014324313300019036MarineMKFLKLSALLIVANAISITTLPDVRPDTVADADIAAHESARAEAAKVKKNPQSALLESIRTDLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAAKLVAKVDTASDETLTEQNAHNIAAMVFYDVQVEDAAASLGMEKNGDLQLAVNRLKSLQKLYLFE
Ga0192945_1016873213300019036MarineLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRADLETMNNDLSFGVSFSQNARNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKNLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192945_1018690513300019036MarineMKFLSVIAILAATSQAVSITTLPDVRADTVADADIAAHEAARADAAKVKKNPQAALLTSIRTDLEQINKDLSFGVSFSQGKRNDHAKELVSKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAGAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192945_1021169213300019036MarineLPDVRSDTVTDADIAAHENARSEAAKVKKNPQTALLETIKEDLETINTNMSFGISYSQTSRNQTARDTCDKVATAIQGYANALINRVEGGPNETLTEQNAHNIAQIIFDDVQLQDAMAGLGMAENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0192945_1024663313300019036MarineLPDVRPDTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYANNLIAKVETGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLSINRLKSLQKLYLFEQQGGENYLG
Ga0192886_1027720813300019037MarineTLPDVRPDTISDADIAAHENARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGASILGYANNLINKVETGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193123_1033963013300019039MarineDTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193123_1039221813300019039MarineHGEAAKVKKNPQSALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVAAAIQDYATKLIAKVEGGANETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLDINRLKSLQKLYLFEQKGGENYLG
Ga0193336_1013204713300019045MarineLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTNRNDHARQLCTKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193336_1021937613300019045MarineMKYTAAALLAVALLVSDTNAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMHGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193336_1027381413300019045MarineKGVTFIQTLPDVRADTVTEKDIAAHEAARAEAAKVKKNPQAALLQSIRTDLESINYDLSFGVSFSQNTRNNRAKALSTKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEENMKELGMEEDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193336_1027385413300019045MarineMKFLTLAMLFASTEAAKLNRHHPYDRQYISTLPDVRADTVADADIAAHEAARAEAAKVKKNPQEPLLTSIRADLEQINKDLSFGVSFSQKSRNDDARALVTKAGASILDYATKLIAKVDSNSDETLTEQNAHNIAAMIFYDVQVQDAANALGMPANSDLNLAVNRLKSLQKLYLFEQKGGENYLGXAMSIANMQ
Ga0193336_1034442913300019045MarineHGDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL
Ga0193336_1048381313300019045MarineHGHELVGTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCSKVGASILDYATKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193336_1066336213300019045MarineEAARAEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193549_1005053913300019047MarineGDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192981_1016090313300019048MarineMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192981_1018737913300019048MarineMKFFTYTIAVAALIASADAASLSSLRKHKHHPVQNELVATLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQSKRNDHARELCTKVGAAIEDYSSKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXTXLSSCSDMCVESQ
Ga0192981_1018884713300019048MarineMKFLTIAAMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXVEEQLMNXAT
Ga0192981_1021180313300019048MarineAIAMLCASAEALNIRTLPDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSL
Ga0192981_1028425113300019048MarineASTDAANLNRHIKGVTFVQTLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNTRNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKGLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193082_1040526913300019049MarineLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0193082_1042418313300019049MarineMKFTVVLAALLFSSVEAAQLNSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKEGQPK
Ga0192966_1015978713300019050MarineMKFFTYTIAVAALIASADAASLSSLRKHKHHPVQNELVATLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQSKRNDHARELCTKVGAAIEDYSSKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192966_1016681913300019050MarineMLLASAEATQLNSLRHHRQIYDRQYIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQSLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192966_1031584413300019050MarineADIAAHEAARADAAKVKKNPQAALLTSIRTDLEQINKDLSFGVSFSQGKRNDHAKELVSKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAGAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXALRKHYACF
Ga0192966_1033883913300019050MarineAAHESARAEAAKVKKNPQTTLLETIKEDLETINTNMSFGISYSQTTRNQTAKDTCTKVGTAIQGYANALINKVEGGPNETLTEQNAHNIAQIIFDDVQLQDAMAGLGMAEDADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0192826_1018688913300019051MarineMKFLTSAAVALLIASTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNLQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0192826_1019157713300019051MarineTSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASIIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLGXKINEDXKSSQ
Ga0192826_1020947513300019051MarinePSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0192826_1021541813300019051MarineEYISTLPDVRADTVSDEDIAAHEAARAEAAKTLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193051_11293113300019084MarineADADIAAHETAREEAAKVKKNPQQTLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0188866_101464113300019095Freshwater LakeIMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0188866_101511013300019095Freshwater LakeMKFFNVASILAIALLVNDSSAHRLSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0188866_101567213300019095Freshwater LakeMKVFNLASILAIALLINDTSAINVGTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG
Ga0188866_101697013300019095Freshwater LakeKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0193153_101341513300019097MarineMKFLTSTVVALLIASSSATSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0193153_101388713300019097MarineMKFLTLSAIAMLFASAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNGELNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192946_103933013300019103MarineTWGIIKILIMKLLSLSVFALLVASSEAANISRHRVKGVTFIQTLPDVRADTVTEKDIAAHETARSDAAKVKKNPQAALLQSIKTDLESINNDLSFGVSFSQNTRNNRARAIATKIGNAVKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEEQMKELQMDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0193243_102372613300019116MarineMKFLTLSAIAMLFASAEAAQLNSLRQHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQQLLNSIRADLEQINKDLSFGVSFSQGSRNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNSDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193243_102876313300019116MarinePHSYQYVSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0193243_103184213300019116MarineRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHEAARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNAHNIAAVIFYDVQLQDAMKGLGMASNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193243_103212813300019116MarineYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193243_103365213300019116MarineSAFRLETLPDVRADTVSDEDIAAHEAARAEASKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0193243_103573813300019116MarineDTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193243_103913813300019116MarineHEFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSDLVLNVNRLKSLQKLYLFEQKGGENYLG
Ga0193243_106190013300019116MarineEAARAEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCSKVGASILDYATKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193054_105721513300019117MarineDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLATIKADLEAINTNMSFGVSYSQTKRNDSARDLCTKVGSSILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193157_102711913300019118MarineTLPDVRSDTVADADIAAHEAARAEAAKVKKNPQTALLASIKADLESINVNLSFGVSYSQTKRNENARDTCTKVGNAILGYANALIAKVESGPNETLTEQNAHNVAAIIFYDVQLQDAMAGLGMAENADLQLAINRLKSLQKLYLFEQKGGENYLG
Ga0193157_103340013300019118MarineADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLSTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0193157_103505413300019118MarineADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLSTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0192980_104203713300019123MarineIIKLTNNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192980_105342613300019123MarineMKFLTIAAMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSL
Ga0192980_105794313300019123MarineDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0192980_105867123300019123MarinePDVRADTVSDEDIAAHELARAEAAKALKNPQSQTLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXA
Ga0192980_106067913300019123MarineRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0192980_106671613300019123MarineDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXNGYRFFXKSNNLEIPYLFGVNX
Ga0192980_108377713300019123MarineIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQSLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0193104_101806313300019125MarineMKFTVILAALLFSSAEAAQLTSLRRHHRHPRGHEFVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLSKVEAAPNEVLTEQNAHNIAAVIFYDV
Ga0193436_104426313300019129MarineTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0193436_105015413300019129MarineHELVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNDMSFGVSYSQTKRNDTARDLCSKVATAILDYSTKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSDLVLNVNRLKSLQKLYLFEQKGGENYLG
Ga0193249_109700013300019131MarineHEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0193249_111814413300019131MarineDIAAHEAARAEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPEDGELVLAINRMKSLQKLYLFEQKGGENYLGXMMIEDXKILANLKDEKLMRVGYKYQKXIKTLVGFA
Ga0193089_107655713300019133MarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARSEAAKIKKNPQAELLATIKADLDQISKDLSFGVSYSQEKRNDHARALCTKVATAINGYADGVTAQVEANTNESMTEMNAHNISAMIFYDVQVQEFMNGLGMAADNTLILAVNRLKSLQKLYLFEQKGGENYLG
Ga0188870_1007118413300019149Freshwater LakeMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0188870_1007295613300019149Freshwater LakeMKFQVILAALFLSSAHATQLQSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADEELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0188870_1008579313300019149Freshwater LakeLLSISAFALLIASSEAASISRQNVKGVTFIQTLPDVRADTVTEKDIAAHEAARAEAAKVKKNPQTALLQSIRTDLETINFDISFGVSFSQNTRNNRARSLATKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEDAMKELNMEDDKQLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0188870_1011000213300019149Freshwater LakeTVESGPNETMTEPAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0194244_1007465313300019150MarineMKFFNVASILAIALLINDTSAHRLQTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQAQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASIIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGKNYLGXKINEDSK
Ga0182087_117080513300019196Salt MarshLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0180036_100883313300019200EstuarineVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNGTSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0182064_106299913300019253Salt MarshSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0182097_140452313300019261Salt MarshKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182066_134409113300019262Salt MarshDTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCNKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDFMSGLGMAPNDALILAVNRLKSLQKLYLFEQKGGENYLG
Ga0182066_146698713300019262Salt MarshKFLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0182061_158022913300019266Salt MarshFLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0182059_100469723300019272Salt MarshVTFVQTLPDQRADTVTEKDIAAHEAARAEAAKVKKNPQAALLQSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEENMKELGLDEDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182059_144819213300019272Salt MarshLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQSARNDHARELVTKASTAILGYANALIAKVDSASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANADLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0182059_146207613300019272Salt MarshAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0182073_115266813300019274Salt MarshKFLTYCALIAAAAATSRHHHHPHSVEYVSTLPDVRADTVSDEEIAAHEAARAEAAKVKKNPQSELIATIKADLDQISKDLSFGVSYSQQKRNDHARDLCNKVASAILGYADGILTQVEAKTSESMTEMNAHNIAAMIFYDVQLQEFMSGLGMAQNDQLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0182073_138508113300019274Salt MarshISMKFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182067_166722223300019276Salt MarshMKFLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVS
Ga0182081_119048613300019277Salt MarshLTYCALIAAAAATSRHHHHPHSVEYVSTLPDVRADTVSDEEIAAHEAARAEAAKVKKNPQSELIATIKADLDQISKDLSFGVSYSQQKRNDHARDLCNKVASAILGYADGILTQVEAKTSESMTEMNAHNIAAMIFYDVQLQEFMSGLGMAQNDQLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0182075_106820113300019282Salt MarshTYCALIAAAAATSRHHHHPHSVEYVSTLPDVRADTVSDEEIAAHEAARAEAAKVKKNPQSELIATIKADLDQISKDLSFGVSYSQQKRNDHARDLCNKVASAILGYADGILTQVEAKTSESMTEMNAHNIAAMIFYDVQLQEFMSGLGMAQNDQLILAVNRLKSLQKLYLFEQKGGENYL
Ga0182075_111455013300019282Salt MarshKFITLGVVALLGATEAAKLDRHIKGVTFVQTLPDVRADTVTEADIAAHEKARAEAAKVKKNPQAGLLQSIRTDLESINFDLSFGVSFSQNARNNRAKALCTKIANAIKDYSTKLITTVDKSPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182058_132969813300019283Salt MarshVKPADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0182058_149303313300019283Salt MarshLTSAVVALLIASSEATSLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0182058_154352113300019283Salt MarshLTLSIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYATKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0182086_100484013300020013Salt MarshLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLASIRADLEQINKDLSFGVSFSQSARNEHAKELVTKAGNAILDYAQKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNAELNLAVHRLKSLQKLYLFEQKGGENYLG
Ga0182044_112984213300020014Salt MarshVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATVKGDLDQISKDLSFGVSYSQEKRNDHARALCNKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDFMSGLGMAPNDALILAVNRLKSLQKLYLFEQKGGENYLG
Ga0206129_1028588813300020182SeawaterTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0206677_1021883213300021085SeawaterIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLG
Ga0206687_107701213300021169SeawaterHPHGHEYLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLRSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206687_131452813300021169SeawaterMKFLSVIAILAATTQAVSITTLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLASIRADLEQINKDLSFGVSFSQGKRNDHAKELVTKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMTANGDLNLSVNRLKSLQKLYLFEQKGGENYLG
Ga0206687_149556513300021169SeawaterKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206687_168273513300021169SeawaterKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLF
Ga0206696_148909813300021334SeawaterNYDYVQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAAVLSSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGNTILDYATKLIAKVESGSDETLTEQNAHNIAAMIFYDVQVEDAGAALAQAPNPDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206691_103546213300021342SeawaterKFFTYTLAVAALISSSEAATLGSLRRHRHHPINYEFISTLPDVRPDTVTEEDIAAHEAARNEAAKVKKNPQAALLATIKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVAGAIEGYASALLTKIESGPNETLTEQNAHNIASVIFYDVQLGDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206691_119495013300021342SeawaterKFLTLSIAMLFASVEATQLNNLHRHHRHLYDREYIATLPDVRADTVADADIQAHEAAREEAAKVKKNPQSALLSSIRADLEQVNKDLSFGVSFSQGNRNEHAKELLAKAGESILDYATKLIAKVNSASDETLTEQNAHNIAAMIFYDVQGQDYANALGMAPNAELNLAINRLKSLQKLYLFEQ
Ga0206691_126821113300021342SeawaterMKLTTLPDVRADTVADADIAAHEAARSEAAKVKKNPQAAVLASVRSDLEQINKDLSFGVSFSQGARNDHAKELVTKVSTTILDYSNKLIAKTESGSDETLTEQNAHNIAAMIFYDVQVEDAGGALGMPPNADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0206691_162664013300021342SeawaterKFLTLSIAMLFASVEATQLNRRHHRHLSDREYVATLPDVRADTVADADISAHEAAREEAAKVKKNPQSALLSSIRTDLEQINKDLSFGVSFSQSSRNEHAKALVTKAGDSILDYATKLIAKVNSASDETLTEQNAHNMAAMIFYDVQVQDAGNALGMTPNADLSLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206691_175928813300021342SeawaterLTRHHHHNYSYVQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAAVLASVRSDLEQINKDLSFGVSFSQGARNDHAKELVTKVSTTILDYANKLIAKTESGSDETLTEQNAHNIAAMIFYDVQVEDAGGALGMPPNADLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206688_1012886313300021345SeawaterVRADTVADQDIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTKRNDHARSLCLKVAKAIKDYSAKLLGKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206688_1017557813300021345SeawaterDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQSIKADLEQINADLSFGISFSQTNRNDHARQLCTKVAKAIKDYSAKLLTKVEAGPNETLTEQNAHNIAAIIFYDVQLQDNMAGLGMGEDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206688_1062598913300021345SeawaterLLSIAMLFAAVEATSLNRHIHGVTFVQTQTLPDVRADTVTEKDIESHEKARADAAKVKKNPQAGLLQSIRTDLETINYDLSFGVSFSQNTRNNRAKAAATKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASLIFYDVQLEEGMKGLGMPQDDQLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206688_1069773813300021345SeawaterKFLSIAAIAMLAASTQAVSITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLGXADXCAFRKSTNTIRMRXWRIXLENIYNEKHHCPATRYALSRKCVLVEVDASINSNS
Ga0206688_1108970813300021345SeawaterKFLTYCALIASTAAVSRRHFPDVTFLETLPDVRPDLVTEGEIAAKESSRSDAAKVKKNPQAALLASIKADLEQVNNDMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQTEDMGAALAMPKNEDLVLAVNRLKSL
Ga0206695_102519913300021348SeawaterKFLSIAAIAMLAASTQAVSITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLGXTDXCAFXKSTHVIEMRWMA
Ga0206692_116696013300021350SeawaterKFLSIAAIAMLAASTQAVSITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0206692_117446113300021350SeawaterYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206692_163257713300021350SeawaterKFLTLIALFATAEATQLNSLRHHRHIYDRQYIATLPDVRADTVADADIDAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLGXAKTFLXNKNYKRIS
Ga0206692_184897513300021350SeawaterMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0206693_146472613300021353SeawaterSTLPDVRPDTVTEEDIAAHEAARNEAAKVKKNPQAALLATIKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVATAIEGYATAVLAKIESGPNETLTEQNAHNIAAVIFYDVQLGDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206693_181500013300021353SeawaterLIMKFFTYTIAVAALVASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206690_1032849513300021355SeawaterVADADIAAHEAARAEAAKVKKNPQTALLASIKSDLEAINTSMSFGVSYSQTKRNENARDLCTKVGNSILGYGNALIAKVESGPNETLTEQNAHNVAAVIFYDVQLQDAMKGLGMAENADL
Ga0206690_1035071713300021355SeawaterFLLIMKFITYVALLATATAVQRHHHHGYNYLQTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLASIKSDLEAINTNMSFGISYSQTKRNENARDLCTKVANSILGYGNALIAKVESGPNETLTEQNAHNVAAIIFYDVQRQDAMKGLGMADNADLQLVVNRLKSLQKLYLFEQKGGENYLG
Ga0206689_1008387213300021359SeawaterMKFLSIAAIAMLAASTQAVSITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLG
Ga0206689_1034013613300021359SeawaterQTMKLLSIAMLFASVEATSLNRHIHGVTFVQTQTLPDVRADTVTEKDIESHEKARADAAKVKKNPQAGLLQSIRTDLETINYDLSFGVSFSQNTRNNRAKAAATKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASLIFYDVQLEEGMKGLGMPQDDQLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206689_1111106313300021359SeawaterKFLTLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0206123_1019221113300021365SeawaterMKVFNLASILAIALLINDTSAINVGTLPDVRADTVSDEDIAAHEAARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLG
Ga0206123_1021503013300021365SeawaterVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLGXAHCCFFXKSILRNEMMAQASTT
Ga0206123_1033238613300021365SeawaterMKFLTLSAFAMLLANTEAITIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANTDLNLAINRLKSLQKL
Ga0206123_1036830813300021365SeawaterMKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNSDLNL
Ga0213861_1045273613300021378SeawaterMKVFNLASILAIALLINDTSAINVGTLPDVRADTVSDEDIAAHEAARADAAKVLKNPQSQLLASIKTDLDQINKDLSFGISFSQTKRNDHARELCTKVASSIMDYSSNLLTTTEAGPEETLTEQNAANLASIMFYDVQLQDAMKGLGMPENGELVLAVNRMKSLQKLYLFEQKGGENYLGXAY
Ga0213864_1027441313300021379SeawaterLSAMRHHHPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQASVLATIKTNLDQISKDLSFGVSYSQSTRNDHARALCTTVATAITAYATNLLSTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0063130_11351013300021867MarineHHHHGHELVSTLPDVRPDTVADSDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDNARDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLSINRMKSLQKLYLFEQKGGENYLG
Ga0063132_11055213300021872MarineFLTLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063146_10395913300021875MarineKFLTSTAVALLIASTEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTL
Ga0063124_14482013300021876MarineVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGSDDELVLAVNRLKSL
Ga0063125_101673513300021885MarineMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEQINADLSFGISFSQTKKNDHARETCQKVSKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDEELVLAVNRLKSL
Ga0063105_104456213300021887MarineFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063122_102834813300021888MarineLTYIALIASTAAVSRRHVPDVTFVETLPDVRPDLVTEGEIAAKESARAESAKVKKNPQAALLASIRADLEAVNNDMSFGVSYSQNKRNDHGQALVTKVSNAIIDYTNKLIGVTNSQPNESLTEQNAHNIAAMIFYDVQTEDAAAALAMPKNEDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063089_104345913300021889MarineKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063873_102070913300021897MarineIMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063144_110885813300021899MarineAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063119_102292013300021901MarineFTLAVAALISSSEAANLSALRRHRHHPVHHEFISTLPDVRPDTVTEEDIAAHEAARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGVSFSQTKRNDHARELCTKVSTAIQDYASKLLSKVESGPNETLTEQNAHNIASVIFYDVQLQDAMKGLGMAGDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063086_105202813300021902MarineAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063131_102303613300021904MarineKFLTSTAVALLIASSSATSLSAMRHHHHPKHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0063088_106840213300021905MarineVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063135_106134013300021908MarineADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0063133_102086113300021912MarineKIMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINGDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0063133_103071613300021912MarineKFLTSTVVALLVASSEATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVL
Ga0063133_103178813300021912MarineYTALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSMMDYTSNLLSTTESGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063133_105000113300021912MarineRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDAGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063104_103644813300021913MarineQIMKFFNVASILAIALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARSEAAKVTKNPQSQLLASIKTDLDQISKDLSFGISFSQSKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEEVLTEQNAANIASVIFYDVQLQDAMKGLGMPE
Ga0063869_103634013300021922MarineLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063085_104557813300021924MarineMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063085_104557913300021924MarineFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063096_100027713300021925MarineKMKFTVVIAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQSALLQTIKADLETINADLSFGISFSQTKKNDHARDTCKKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDV
Ga0063096_103772513300021925MarineNNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0063096_103772613300021925MarineAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0063103_105164713300021927MarineIEIMKYQLIIAALFASTASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETSLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0063145_102387413300021930MarineASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0063145_110485813300021930MarineHGHEFVSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDGMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0063756_101250913300021933MarineKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0063139_115254713300021934MarineMLLAATNAVSIQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASIRADLEQINKDLSFGVSFSQGKRNDHAKELVTKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXDQMKLRK
Ga0063138_112851713300021935MarineDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVSTSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0063095_104860413300021939MarineYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063095_115265813300021939MarineFNVASILAIALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARSEAAKVTKNPQSQLLASIKTDLDQISKDLSFGISFSQSKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEEVLTEQNAANIASVIFYDVQLQDAMKGLGMPE
Ga0063108_101808513300021940MarineVRADTVSDEDIASHEAARAEAAKAMKNPQNSVLATIKEDLDQISKDLSFGVSYSQSTRNDHARVLTAKVQTAITGYATTLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGQTASDDLILAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0063102_102052113300021941MarineEIMKYQLIIAALFASTASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETSLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0063094_101612213300021943MarineKMKFTVVIAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQSALLQTIKADLETINADLSFGISFSQTKKNDHARDTCKKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNSAGLGMGADDELVLAVNRLKSL
Ga0063094_105054513300021943MarineEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063101_104883713300021950MarineIMKFLSVIAILAATSQAVSITTLPDVRADTVADADIAAHEAARVEAAKVKKNPQAALLTSIRADLEQINKDLSFGISFSQGKRNDHAKELVTKVSSAILDYAGKLIAKVDGASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMSANGDLNLSVNRLKSLQKLYLFEQKGGENY
Ga0063101_109367113300021950MarineKLLSTIALLVASSEAANISRHNIKGVTFLQTLPDVRADTVTEKDIVAHETARADAAKVKKNPQAALLGSIRTDLESINYDISFGVSFSQNTRNNRAKALATKISNAIKDYANKLIGTVDKSPNDALTEQNAHNIASMIFYDVQLEDNMRELGLDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0063101_113626013300021950MarineVSDEDIAAHEAARAEASKTKKNPQGTLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0063755_101345913300021954MarineIMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGKSAPDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0063755_106481713300021954MarineSDEDIAAHEAARSEAAKVTKNPQSQLLASIKSDLDQISKDLSFGISFSQSKRNDHARELATKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPEQGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0222717_1027409113300021957Estuarine WaterMKFLSIAAIAMLAASTQAVSITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNEHAKELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0222716_1048650313300021959Estuarine WaterIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLGXAKSILVLQEL
Ga0222714_1032834223300021961Estuarine WaterHPHSVEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIRADLDQISKDLSFGVSYSQAKRNDHARGLCTKVATAILGYADGITAQVEAKTNESMTEMNAHNISAMIFYDVQLQEFMNGLGMAPNDNLNLAVNRLKSLQKLYLFEQKGGENYLGXTLXGVDVRLFLRX
Ga0222713_1030646713300021962Estuarine WaterMKFITLGVLALLGATEAAKMERHIKGVTFVQTLPDVRADTVTEADIAAHERARAEAAKVKKNPQAGLLQSIRTDLESINYDLSFGVSFSQNGRNNRARALCTKIANAIKDYSSKLITTVDKAPDDALTEQNAHNIASLIFYDVQLEDNMKTLGMDQDKDLVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0222713_1036387713300021962Estuarine WaterMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0255781_1018553913300022934Salt MarshMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCNKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDFMSGLGMAPNDALILAVNRLKSLQKLYLFEQKGGENYLG
Ga0255784_1022871413300023108Salt MarshMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0228679_101443613300023566SeawaterAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0228679_103609913300023566SeawaterEAAKVKKNPQAALLASIKADLEAINTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYANNLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0228697_11228713300023674SeawaterNNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0232114_11749913300023676SeawaterLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0228681_102147613300023683SeawaterLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0228683_101515713300023694SeawaterKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0228680_104315513300023695SeawaterAEAAKVKKNPQAALLATIKADLESINTNMSFGVSYSQTKRNETARDLCTKVGASILDYANKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0228682_103579813300023698SeawaterDTVSDEDIAAHELARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0228684_106365913300023704SeawaterKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
(restricted) Ga0233435_110012213300024252SeawaterMKFLTLSIAMLFASVEATQLNRRHHRHLSDREYVATLPDVRADTVADADISAHEAAREEAAKVKKNPQSALLSSIRTDLEQINKDLSFGVSFSQSSRNEHAKALVTKAGDSILDYATKLIAKVNSASDETLTEQNAHNMAAMIFYDVQVQDAGNALGMTPNADLSLAVNRLKSLQKLYLFEQKGGENYLG
(restricted) Ga0233439_1018432213300024261SeawaterMKFLTLSIAMLFASVEATQLNRHHHRHLSDREYVATLPDVRADTVADADISAHEAAREEAAKVKKNPQSALLSSIRTDLEQINKDLSFGVSFSQSSRNEHAKALVTKAGDSILDYATKLIAKVNSASDETLTEQNAHNMAAMIFYDVQVQDAGNALGMTPNADLSLAVNRLKSLQKLYLFEQKGGENYLG
Ga0244777_1027109223300024343EstuarineMKFLTYCALIAATAAVQRHHHHPHSVEYVATLPDVRADTVSDEDIAAHESARAEAAKVKKNPQAELLATIKGDLDQISKDLSFGVSYSQEKRNDHARALCTKVATAILGYADGITAQVEANTNESMTEQNAHNISAMIFYDVQVQDYMSGLGMAANDALILAVNRLKSLQKLYLFEQKGGENYLG
Ga0244775_1051477813300024346EstuarineMKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209716_108803523300025626Pelagic MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0209136_111913213300025636MarineMKFLTYCALIASAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARSEAAKIHKNPQAELMATVKNDLDQISKDLSFGVSYSQQKRNDHARELCNKVATAILGYADGVTAQVEAKTNEMMTELNAHNISAFIFYDVQLQEFMNGLGMAANDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0209306_113123313300025680Pelagic MarineHHHNSELVATSTLPDVRADTVADTDIAAHEKARSEAAKVKKNPQASLLASLKTDLEQINKDLSFGVSFSQGKRNDHAKELCTKVSNSIVGYSKKLITKVEGNSNETLTEQNAHNIAAMIFYDVQLEDAMKALGMSSDEERTLYVNRLKSLQKLYLFEQKGGENYLG
Ga0209505_106619813300025690Pelagic MarineMKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0209602_117181023300025704Pelagic MarineDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQTKRNDIARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0209832_114565313300025830Pelagic MarinePKPQNPTKMTSIQLIFLDHFSYNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0209603_127599823300025849Pelagic MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAA
Ga0209603_128271313300025849Pelagic MarineMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKL
Ga0209308_1023153113300025869Pelagic MarineKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKASGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLGXAAXCFSRKKHQIAEK
Ga0209308_1040293513300025869Pelagic MarinePKPQNPTKMTSIQLIFLDHFSYNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENG
Ga0208783_1015613813300025872AqueousMKFITLSTFALLIASSEAAIINKHVKGVTFVQTLPDVRADTVTEADIAAHERARADAAKVKKNPQSALLQSIRGDLEAINFDLSFGVSFSQNNRNNRAKALCTKIGNAIKDYAEKLITTVDKAPDDALTEQNAHNIASMIFYDVQLEDNMKTLGMDEDKDLVLAVNRLKALQKLYLFEQKGGENYLS
Ga0209555_1016157913300025879MarineMKFIATLAVALLVCNTEATSLLRRHHHPHSHELVATLPDERPEVVSEADIAAREAARAEAAKVRKNPQAALLASMRADLEQINTDMSFGVSYSQGKRNDEARGLCTKVASAIKQYAKQLIGKVDGGAKSGQPVLTEQNAHNIASVIFYDVQLEDAMKGLGMAEDGELVLAVNRLKSLQKLYLFEQQGGENYLE
Ga0209309_1024324323300025881Pelagic MarinePSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0208544_1016868613300025887AqueousMKFLSVATIALCVASSQAVTRHPVRGVTFVQTLPDVRTDSVTEADIAAHEAARADAAKVKKNPQSSLLQSIKADLEQINNDMSFGISFSQSSRNQHAKELCVKIANAVQDYAKKLISTVDQSPNETLTEQNAHNIASMIFYDVQLEDSMKALGMPENNDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209631_1018901013300025890Pelagic MarineMKFLSIAAVAMLCASAEAVSISTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSIRADLEQINKDLSFGVSFSQTARNDHARELVTKAGGAILGYANALIAKVDTASDETLTEQNAHNIAQMIFYDVQVQDAGAALAMAPNTDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0209631_1019888823300025890Pelagic MarineMKFLTLSAFAMLLANTEAITIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHARELVTKASTAILGYANALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANTDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0209335_1041170013300025894Pelagic MarineVATSTLPDVRADTVADTDIAAHEKARSEAAKVKKNPQASLLASLKTDLEQINKDLSFGVSFSQGKRNDHAKELCTKVSNSIVGYSKKLITKVEGNSNETLTEQNAHNIAAMIFYDVQLEDAMKALGMSSDEERTLYVNRLKSLQKLYLFEQKGGENYLG
Ga0209425_1024575913300025897Pelagic MarinePKPQNPTKMTSIQLIFLDHFSYNFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVATGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVLKEGSNSLXVSL
Ga0209961_105089313300026130WaterHQYIATLPDVRADTVSDADIAAHENARADAAKVKKNPQASLLASIKADLEQINKDLSFGVSFSQAKRNDHAKELATKVSNAIVGYAKKLITKVETKPDEALTEQNAHNIAAMIFYDVQLEDAQKSLGMAADEERQLFVNRLKSLQKLYLFEQKGGENYLGXMXNXFNTNKNESRVRV
Ga0247557_103111713300026403SeawaterDVRADTVSDADIAAHEAARQEAAKVKKNPQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCTKVGTSIQDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLSINRLKSLQKLYLFEQKGGENYLG
Ga0247557_103175113300026403SeawaterVSTLPDVRADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNNDMSFGVSYSQTKRNDTARDLCSKVATSILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0247559_110058913300026443SeawaterFVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDAGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247607_104119313300026447SeawaterLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247607_105346813300026447SeawaterDIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINGDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247607_109620513300026447SeawaterADTVSDADIAAHEAARAEAAKVKKNPQAALLATIKADLESINTNMSFGVSYSQTKRNETARDLCTKVGASILDYANKLIAKVEGGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0247594_103224113300026448SeawaterMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247594_104779413300026448SeawaterMKFLTYCALIASAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARSEAAKIHKNPQAELMATVKNDLDQISKDLSFGVSYSQQKRNDHARELCNKVATAILGYADGVTALVEAKTNEMMTELNAHNISAFIFYDVQLQEFMNGLGMAPNDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0247594_105954813300026448SeawaterDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVL
Ga0247593_106057713300026449SeawaterFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247578_105240313300026458SeawaterYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247600_104525113300026461SeawaterIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247588_104670313300026465SeawaterNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247603_105376913300026468SeawaterALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247599_105459413300026470SeawaterEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247599_109261713300026470SeawaterTLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLGXAKSILVLQEL
Ga0247571_105918513300026495SeawaterFIIKLTNNIEIMIYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEADRAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247571_108801713300026495SeawaterHVELVSTLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0247571_111179913300026495SeawaterYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247571_116757013300026495SeawaterADSDIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNSNMSFGVSYSQTKRNDSARDLCTKVGASILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0247592_107083413300026500SeawaterIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247592_107726613300026500SeawaterATLPDVRPATVSAADIAAHEAARSEAAKDKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGTSILGYANSLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0247592_107881113300026500SeawaterLTYCALIASAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARSEAAKIHKNPQAELMATVKNDLDQISKDLSFGVSYSQQKRNDHARELCNKVATAILGYADGVTALVEAKTNEMMTELNAHNISAFIFYDVQLQEFMNGLGMAPNDTLILAVNRLKSLQKLYLFEQKGGENYLSXAS
Ga0247587_107151313300026504SeawaterNKIMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0208020_103342223300027159EstuarineMKFLTISAFALLIASAEAASLGRHPVRGVTFVQTLPDVRADTVTENDIKAHETARAEAAKVKKNPQASLLHSIKTDLEQINNDISFGVSYSQSKRNAHAKELAVKIGNAIQDYAKKLITTVDKSPNESLTEQNAHNIASMIFYDVQLEDSMKELGMSENKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0208921_102538213300027188EstuarineMKFLTLSAYALLIVSTEAAILKRHNVPGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNGTSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0208026_103458913300027236EstuarineGVTFLQTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLASVKADLEEINNDMSFGVSYSQKSRNEHAVGLCQKVATAIIDYSKNLINNVNTSSADNKLTEQNAHNIASMIFFDVQLEDAMAALGMSPNEELILNVNRLKSLQKLYLFEQVGGENYLG
Ga0209710_113647723300027687MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTAMSFGISYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0208305_1024036213300027753EstuarineMKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLDVNR
Ga0208671_1015440013300027757EstuarineMKFLTYCALIAATAAVQRHHHHPHSVEYVSTLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGMAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209502_1020333923300027780MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0209092_1026269423300027833MarineMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0209404_1044618513300027906MarineRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0247584_110243913300028110SeawaterVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247584_112580213300028110SeawaterSAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247584_112779813300028110SeawaterVSTLPDVRADTVSDADIAAHEAARQEAAKVKKNSQAALLASIKADLEAVNTNMSFGVSYSQTKRNDNARDLCTKVGTSIQDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLSINRLKSLQKLYLFEQKGGENYLG
Ga0256411_112293713300028134SeawaterKIMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0256411_118900113300028134SeawaterVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQLDTLVAIKLDLDQISKDLSFGVSYSQQKRNDHARALCTKVAAAIQGYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMAADDNLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0256412_115665313300028137SeawaterIMKFTVVLAALLLSSAEAVTSLRKHRHPHRREYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0256412_116228513300028137SeawaterKFFTYTIAVAALVASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0256412_117863113300028137SeawaterLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYL
Ga0256412_118412413300028137SeawaterHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0256412_119703313300028137SeawaterLTSTAVALLIASTEAASLSSMRHHHYPSHYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKARKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0256412_119958113300028137SeawaterLTLSAILFATAEAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0256412_122464813300028137SeawaterRPHHHPASVEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQLDTLVSIKLDLDQISKDLSFGVSYSQQKRNDHARALCTKVAAAIQGYADGVTAQVEAKTNESMTELNAHNISAMIFYDVQLQEFMSGLGMAADDNLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0256417_108620913300028233SeawaterMKFTVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0256417_108893713300028233SeawaterKIMKFTVVLAALLFSSVEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0256417_114766913300028233SeawaterSSAHRLSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0256413_115700013300028282SeawaterVVLAALLFSSAEAVTSLRKHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0256413_116293713300028282SeawaterYTLAVAALIASTDAAAISSLRRHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLAKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMPGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0256413_117298913300028282SeawaterKFFNVASILAIALLVNDSSAHRLSTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELATKVAGSIQDYCSNLLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAMKGLGMPENGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0256413_117809913300028282SeawaterLLVASSGATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYL
Ga0256413_118267813300028282SeawaterYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0256413_119664613300028282SeawaterKFLTYCALIASAAAVQRHHHHPHSVEYVSTLPDVRADTVSDEDIAAHEAARSEAAKIHKNPQAELMATVKNDLDQISKDLSFGVSYSQQKRNDHARELCNKVATAILGYADGVTALVEAKTNEMMTELNAHNISAFIFYDVQLQEFMNGLGMAPNDTLILAVNRLKSLQKLYLFEQKGGENYLS
Ga0256413_133195113300028282SeawaterLTLSAILFATADAAQLNSLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLF
Ga0256413_133228713300028282SeawaterHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247572_107856813300028290SeawaterLKLIMKFFTYTIAVAALVASADAAAISSLRRHRHHPSHHEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247572_108104513300028290SeawaterLMRLPELKPPRPLRTHKTPFLPPSRPILTRSPRISLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0247572_108716013300028290SeawaterPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAIYADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0247572_110552213300028290SeawaterDIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247595_104373013300028333SeawaterKFLTLTIAMLFASVEGAQLNSLRRHHRHIYDREYVATLPDVRADTVADADIEAHEQARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQTSRNEHAKELVTKAGNAILDYASKLIAKVNSASDETLTEQNAHNIAAMIFYDVQLQDAGNALGLAPNADLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0247597_104625913300028334SeawaterADTVSDTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNNDMSFGVSYSQTKRNDTGRDLCSKVATSILDYSNKPIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMTENSELVLAVNRLKSLQKLYLFEQRGGENYLG
Ga0247566_103118513300028335SeawaterIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAADEELVLAVNRLKSL
Ga0247566_106449413300028335SeawaterRADTVADADIEAHEAARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGTAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNALGMAPNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0306910_102783213300028412Saline LakePQNPKTPKPHESDSLKLFIIIKLIMKFLSLSAIAMLVASTDAASIRRHHNIKGVTFIQTLPDQRADTVTEKDIAAHETARADAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTVKIANAIKDYSNKLISTVDKSPDEALTEQNAHNIASMIFYDVQLEENMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0304731_1049890213300028575MarineHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVSKAIKDYTSKLLSKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMSSDEELVLAVNRLKSL
Ga0304731_1072148813300028575MarineELVSTLPDVRPDTVADSDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDAGRDLCTKVGTSILDYADKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQKGGENYLG
Ga0304731_1075497613300028575MarineLALAALLFTVEGAQLGSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARAEVSKVKKNPQSALLQTIKADLETVNADLSFGISFSQTKRNDHARETCLKVAKAIKDYTGKLLAKVEGAPNEVLTEQNAHNIAAVIFYDVQLQDNMAGLGMGVDADLVLAVNRLKSLQKLYLFEQK
Ga0304731_1111481813300028575MarineTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0272440_116408813300028595Marine SedimentMKYITIAVACLMASTQAVTLQTLPDAREDLVADADIAAHESARAEAAKVKKNPQANLLATIRTDLEQVNKDLSFGVSYSQAKRNDHSRQLCTKIASSIKDYSSQMLSKVESGPNETLTEQNAHNIAQIIFEDVQLQDAMKQLEMPIDGELVLAMNRMKSL
Ga0272440_117142113300028595Marine SedimentMKYISIALALFLATAEARRYHYPESYEFVSTLPDARDETVADADIAAHEAARAEAAKVKKNPQTNLLNTIKADLEQINKDMSFGVSFSQGNRNDHARQLCTKVASAVKDYSSQLLTKIEAGPNETLTEQNAHNIAAVIFYDVQLQDAMKGLGMAMDGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0257132_112494413300028671MarineFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAELLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSAKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMASNGDLVLAVNRLKSLQKLYL
Ga0307402_1047000613300030653MarineFLTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLGXEIPFLVMQEL
Ga0307403_1031666613300030671MarineIKIINKTMKFTVVIAALLFSSAQAAQLTSLKRHHTHRPHGHAYVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETVQKVSKAIKDYTSKLLAKIETGPNEVLTEQNAHNIAAVIFYDVQL
Ga0307403_1082994013300030671MarineAMLCASAEALNIRTLPDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSL
Ga0307398_1035950113300030699MarineKLFSLSAIALLIASTEAANLNRHIKGVTFVQTLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNARNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKNLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307398_1036708213300030699MarineVVLAALLFSSAEAVQRKHHNKHPVGVSLMSTLPDVRADTVADADIAAHEAARAEAAKVKKNPQSSLIQTIKADLEQINDDLSFGISFSQTKKNDHAREVCAKVATAIKDYSDKLLKKVEAGPNETLTEQNAHNMAAIIFYDVQL
Ga0307398_1038404213300030699MarineMKLLSTIALLVASSEAANISRHNIKGVTFVQTLPDVRADTVTEKDIAAHEASRADAAKVKKNPQSALLTSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKIANAVKDYANKLIGTVDKSPNDALTEQNAHNIASMIFYDVQLEDNMRELGLDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0307398_1080422013300030699MarineQAVSITTLPDVRADTVADADIAAHEAARVEAAKVKKNPQTALLTSIRADLEQINKDLSFGISFSQGKRNDHAKALVSKVSTAILDYAGKLISKVDGASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMTANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307399_1024767713300030702MarineNNIEIMKYQLIIAALFASTASGAQLSSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQAMKADLETINSDLSFGISFSQTKRNDHARETCLKVAKAIKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307399_1029399713300030702MarineFLSLAAIAMLCASAEALNIRTLPDVRDDTVADADIAAHESARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXNGYRFFXKSNNLEIPYLFGVNX
Ga0307399_1036390513300030702MarineMKFLTIAAMLFASAEAIHIQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANSLAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXVEEQLMNXATFGK
Ga0307400_1050078713300030709MarineKYTIAILALALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARAEASKVTKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELCTKVSGSIQDYCSALLTTTEAGPEETLTEQNAANIASVIFYDVQLQDAIKGLGMPE
Ga0308127_102754923300030715MarineVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0308127_103100613300030715MarineVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTAMSFGISYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0308127_103759313300030715MarineVSTLPDVRADTVADTDIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTNMSFGVSYSQSKRNDSGRDLCNKVSTAILDYSNKLIGKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMAENSELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308139_103137013300030720MarineFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAELLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSAKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMASNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308138_103517313300030724MarineAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308128_102737013300030725MarineTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0308128_102974113300030725MarineEAARAEASKTKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXEISEGPRALNVSLXNQXE
Ga0308126_103421113300030726MarineHHPHHVELVSTLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELTTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGQAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308131_107110013300030729MarineIASHEAARAEAAKAMKNPQNSVLATIKEDLDQISKDLSFGVSYSQSTRNDHARVLTAKVQTAITGYATTLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGQAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXA
Ga0073988_1002547813300030780MarineDVRADTVADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAVNTDMSFGVSYSQTKRNDTARDLCTKVGASILDYATKLIAKVESGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSDLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0073988_1206389513300030780MarineMKFFTTLAIALLVSSADAAQLNAMKKHHKHHHQLVQTLPDVREETPTESDIAASELARSNAAKVTKNPQASLLATIKSDLDQINKDVSFGVSFSQNPRNTHAKELCVKIANAIQDYSDSLVKKTDSNPNETLTEQNAHNMAQVIFYDVQLQDNMALLGMPANAELNLSVNRLKSLQKLYLFEQKGGENYLD
Ga0073990_1203831013300030856MarineDVRADTVSDADIAAHEAARAEAAKVKKNPQAALLATIKSDLEAINTNMSFGVSYSQTKRNDTARDLCTKVGGAILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENADLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0073990_1204327813300030856MarineTLPDVRADTVSDEDIAAHEAARSEAAKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0073981_1170962613300030857MarineLAVAALISSSEAANLGSLRKHRHHPSHHEFISTLPDVRPDTVTEEDIAAHEAARSEAAKVKKNPQAALLASMKTDLEQINKDMSFGVSFSQTNRNDHARELCQKVATAIQDYSSKLLAKVESGPNETLTEQNAHNIASVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073981_1171607313300030857MarineDTVSDEDIAAHEAARAEAAKTLKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073987_1114792413300030912MarineHHEFISTLPDVRPDTVTEEDIASHEAARAEAAKVKKNPQAALLASMKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVATAIQDYASKLLSKVESGPNETLTEQNAHNIASVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073987_1122263813300030912MarineYEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0073977_150042113300030948MarineKLLSLSAFALLIASSEAASISRHNVKGVTFIQTLPDVRADTVTEKDIAAHEAARAEAAKVKKNPQAALLQSIRTDLESINYDLSFGVSFSQNTRNNRAKALSTKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEENMKELGMEEDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073942_1176605613300030954MarineFRLETLPDVRADTVSDEDIAAHEAARAEASKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0073942_1186604513300030954MarineSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073943_1163284313300030955MarineKFLTSAAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073944_1127902113300030956MarineYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKVKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0073984_1124962813300031004MarineAARAEAAKVKKNPQAALLASIKSDLEAINTNMSFGVSYSQTKRNDTARDLSTKVAGAILDYATKLIAKVEGGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENAELVLAINRLKSLQKLYLFEQQGGENYLG
Ga0073980_1000469213300031032MarineHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073980_1000502513300031032MarineMKFLTSTAVALLLASTEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0073979_1001061913300031037MarineTEAASLSAMRHHHHPSHYEFVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0073979_1244725013300031037MarineSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGVSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073989_1001118113300031062MarineEYVSTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLTTVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMAAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073989_1001525813300031062MarineMKFLTSTVVALLIASSEATQISAMRHHNHYPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKVLKNPQNAVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0073989_1002298413300031062MarineDEDIAAHEAARAEAAKVLKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLCTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGMSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0073989_1347137413300031062MarineVAALISSSEAANLGSLRKHRHHPSHHEFISTLPDVRPDTVTEEDIASHEAARAEAAKVKKNPQAALLASMKTDLEQINKDMSFGVSFSQTKRNDHARELCQKVATAIQDYASKLLSKVESGPNETLTEQNAHNIASVIFYDVQLQDAMKGLGMPGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0073989_1353767013300031062MarineMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQAALLQTIKADLESINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSSDDELVLAVNRLKSL
Ga0073989_1356748413300031062MarineRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEQINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMSGLGMASDDELVLAVNRLKSL
Ga0073989_1360280223300031062MarineSAFRLETLPDVRADTVSDEDIAAHEAARAEAAKVKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLMDYTSNLLATTEAGPEETLTEQNAANIASVLFYDVQLQDAMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0073962_1126209413300031126MarineALLIASSEAASISRHNVKGVTFIQTLPDVRADTVTEKDIAAHEAARAEAAKVKKNPQAALLQSIRTDLESINYDLSFGVSFSQNTRNNRAKALSTKISNAIKDYANKLITTVDKSPNDALTEQNAHNIASMIFYDVQLEENMKELGMEEDKDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307980_104864213300031216Saline WaterMKFLSLSAIAMLVASTDAASIRRHHNIKGVTFIQTLPDQRADTVTEKDIAAHETARADAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTVKIANAIKDYSNKLISTVDKSPDEALTEQNAHNIASMIFYDVQLEENMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0307981_112492013300031223Saline WaterPKTPKPHESDSLKLFIIIKLIMKFLSLSAIAMLVASTDAASIRRHHNIKGVTFIQTLPDQRADTVTEKDIAAHETARADAAKVKKNPQASLLQSIKTDLESINYDLSFGVSFSQNTRNNRAKSLTVKIANAIKDYSNKLISTVDKSPDEALTEQNAHNIASMIFYDVQLEENMRELGVEQDHELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0308145_104388613300031378MarineLPDVRADTVSDEDIASHEAARAEAAKAMKNPQNSVLATIKEDLDQISKDLSFGVSYSQSTRNDHARVLTAKVQTAITGYATTLLATVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGQTASDDLILAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0307388_1050622413300031522MarineKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0307388_1054658213300031522MarineYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDVAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0307388_1058050213300031522MarineKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0307388_1064031013300031522MarineMKFLKLSALAMLLVATEAISITTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLTSIRVDLEQINKDLSFGISFSQGKRNDHAKELVAKVINGIIDYAAKLIAKVDTASDETLTEQNAHNIAAMVFYDVQVQEAAAQLGLAPNTDLNLAVNRLKSLQKLYLFEQKGGENYLGXDQMKFLY
Ga0307388_1120018213300031522MarineKFLSVIAILAATSQAVSITTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGVSFSQGKRNDHAKELVTKVSSAILDYAGKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENY
Ga0307492_1021095713300031523Sea-Ice BrineLRHHRHIYDREYIATLPDVRADTVADADIEAHEAARAEAAKVKKNPQQTLLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGAAILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMASMGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307492_1026492213300031523Sea-Ice BrineIYDREYIATLPDVRADTVADADIEAHESARAEAAKVKKNPQQTLLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGLASNGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308143_11798313300031540MarineKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTAMSFGISYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0308149_101851113300031542MarineMKFTVVIAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQSALLQTIKADLETINADLSFGISFSQTKKNDHARDTCKKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNSAGLGMGADDELVLAVNRLKSL
Ga0308149_102074613300031542MarineIMKYQLIIAALFASTASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0308147_103399913300031558MarineRPATPTEADIAAHESARATAAKVKNNPQQVLLTSMKADLEQINKDMSFGVSFSQSKRNDHARELCTKVSNAVQDYAAKLLAKVESGANESLTEQNAHNIGAVIFYDVQLQDAMKGLGMPEAAELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307489_1030451813300031569Sackhole BrineMKFFTYCALIAATVAVQRHHNHHPHSVEFVATLPDVRADTVSDEDIAAHEAARSEAAKIKKNPQSELLATIRADLDQISKDLSFGVSYSQAKRNDHARALCTKVGTAILGYADGITAQVEAKTNESMTELNAHNISGMIFYDVQLQEFMNGLGMASNDSLILAVNRLKSLQKLYLFEQKGGENYLG
Ga0307489_1036210113300031569Sackhole BrineMKFMSLSAFALLIASTEAANINRHNIKGVTFLQTLPDVRSDTVNEKDIVAHEKARSDAAKVKKNPQSSLLESMRTDLEAINHEISFGVSFSQNNRNNRGRALCKKVGGAVKEYANKLIDVVEKQPNEALTEQNAHNIASMIFHDVQLEDSMKELGMDEDKELQLAVNRLKSLQKLYLFEQKGGENYLE
Ga0307489_1050171823300031569Sackhole BrineMKFFTYCALIAATAAVQRHHNHHPHSVEFVATLPDVRADTVSDEDIAAHEAARSEAAKIKKNPQAALLATIRSDLDQISKDLSFGVSYSQAKRNDHARSLCTKVGAAILGYADGITTQVEAKTNESMTELNAHNISAMIFYDVQLQEFGKGLGMAGNDQLDLAVNRLKSLQKLYLFEQKGGENYLG
Ga0308144_104452713300031570MarineMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVN
Ga0308134_107129013300031579MarineKFFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAELLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSAKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMASNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0302114_1017109413300031621MarinePKPQNPKEMKNHSVNLSVIILYNLIPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQAQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSNLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0302114_1041527313300031621MarineMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVET
Ga0302126_1008460223300031622MarineMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSL
Ga0302125_1009133213300031638MarineMKFFTYTLAVAALVASTDAAAISSLRKHKHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAELLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSAKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMASNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXTXLSFVLKHGAESQQ
Ga0302125_1023598213300031638MarineYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0307393_105609113300031674MarineALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307393_107946513300031674MarineKFLTLSAILFATAEAAQLNSLRHHHHIYDREYIATLPDVRADTVADADIAAHESAREEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYADKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAADGKLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307998_117115413300031702MarineMKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLGXT
Ga0307386_1029221313300031710MarineKFTVVLAALLFSSAEATHSLKRHHRHPHGVQYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEIINSDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMGGLGMGGDDELVLAVNRLKSL
Ga0307386_1033004313300031710MarineNKIMKFTVVIAALLLSSAEAVTSLRKHRHPHRHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSGDDELVLAVNRLKSL
Ga0307386_1040116513300031710MarineLTLSAIAMLLASTEATQLNSLRHHRQIYDRQYIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQTLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307386_1050792013300031710MarineAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307386_1054855413300031710MarineQIMKFYQILALIAATQAVSITTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLESIRVDLEQINKDLSFGVSFSQGKRNDHAKELVTKVSSAILDYANKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMAVNGDLNLSVNRLKSLQKLYLFEQKGGENYLG
Ga0307386_1064526313300031710MarineMKFLKLSALAMLLVATEAISITTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLTSIRVDLEQINKDLSFGISFSQGKRNDHAKELVAKVINGIIDYAAKLIAKVDTASDETLTEQNAHNIAAMVFYDVQVQEAAAQLGLAPNTDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307386_1072288613300031710MarineEYLATLPDVRADTVADADIASHEAARAEAAKVKKNPQSALLQTIKADLEGINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMTSDDELVLAVNRLKSL
Ga0307396_1053304913300031717MarineLFSLSAIALLIASTEAANLNRHIKGVTFVQTLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNARNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKNLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307381_1015152013300031725MarineVRADTVADADIAAHEAARSEAAKVKKNPQSALLQTIKADLEGINNDLSFGISFSQTKRNDHARELCTKVGTAIKDYSKKLLSKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMAGDGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307381_1015748713300031725MarineIINKIMKFTVVIAALLLSSAEAVTSLRKHRHPHRHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSGDDELVLAVNRLKSL
Ga0307381_1026342713300031725MarineMKFLKLSALLIVANAISITTLPDVRPDTVADADIAAHESARAEAAKVKKNPQSALLESIRTDLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAAKLVAKVDTASDETLTEQNAHNIAAMFFYDVQVEDAAASLGMEKNGDLQLAVNRLKSLQKLYLFE
Ga0307381_1028551513300031725MarineLTIIAIIAATTQAISITTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGISFSQGKRNDHAKELVSKVSTAILDYAGKLISKVDGASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307381_1028637513300031725MarineLTSTVVALLVASSEATSLQAMRHYRPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNAVLATIKTDLDQISKDLSFGVSYSQSSRNDHARTLTTKVATAITDYATNLLATVEAGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLG
Ga0307381_1037549713300031725MarineSIAAIAMLCASTQAISITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADVEQINKDLSFGVSFSQTARNDHAKELVTKASTAILGYANALIAKVDSASDETLTEQNAHNISAMIFYDVQVNDASNALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0307391_1038641913300031729MarineKIMKFFNVASILAIALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARGEAAKVKKNPQSQLLASIKTDLDQISKDLSFGISFSQSKRNDHARELCTKVSGSIQDYASNLLTTTEAGPEETLTEQNAANIASVLFYDVQLQDAIKGLGMPEQGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0307391_1039032513300031729MarineINKTMKFTVVIAALLFSSAQAAQLTSLKRHHTHRPHGHAYVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETVQKVSKAIKDYTSKLLAKIETGPNEVLTEQNAHNIAAVIFYDVQL
Ga0307391_1041662913300031729MarineKLLSTIALLVASSEAANISRHNIKGVTFVQTLPDVRADTVTEKDIAAHEASRADAAKVKKNPQSALLTSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKIANAVKDYANKLIGTVDKSPNDALTEQNAHNIASMIFYDVQLEDNMRELGLDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0307391_1042726513300031729MarineFTYTIAVAALIASADAASLSSLRKHKHHPVQNELVATLPDVRPDTVTEEDIAAHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQSKRNDHARELCTKVGAAIEDYSSKLLGKIESGPNETLTEQNEHNISAVIFYDVQLQDAMKGLGMAGNGDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307391_1093133913300031729MarineASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYL
Ga0307397_1032503623300031734MarineMKFLTIAAMLFASAEAIHLQTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALMDSVRADLEQINKDLSFGVSFSQTTRNEHAKELVTKASTSILTYADALIAKVDTASDETLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYLGXVEEQLMNXATYKK
Ga0307394_1019043513300031735MarineNNIEIMKYQLIIAALFASAASGAQLNSLRRHHHPHRHEFLATLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLQSMKADLETINADLSFGISFSQTKRNDHARETCLKVAKSVKDYSAKLLAKVEAGPNETLTEQNAHNIAAVIFYDVQLQDNMAGLGMSADDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307394_1022882013300031735MarineKFLTLSAIAMLLASTEATQLNSLRHHRQIYDRQYIATLPDVRADTVADADIAAHETAREEAAKVKKNPQQTLLNSIRTDLEQINKDLSFGVSFSQGARNEHAKELVTKAGASILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMSANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307394_1028220913300031735MarineMKFLKLSALAMLLVATEAISITTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLTSIRVDLEQINKDLSFGISFSQGKRNDHAKELVTKVINGIIDYAAKLIAKVDTASDETLTEQNAHNIAAMVFYDVQVQEAAAQLGLAPNTDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307387_1046658013300031737MarineKLFSLSAIALLIASTEAANLNRHIKGVTFVQTLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNTRNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKNLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307387_1059610713300031737MarineKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDVAAHEAARAEAAKAKKNPQSQLLASVKTDLDQISKDLSFGISFSQSKRNDHARELWTKVANGLQDYTSNLLSTTEAGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0307387_1083924713300031737MarineDIAAHEAARQEAAKVKKNPQAALLASIKADLEAINNDMSFGVSYSQTKRNETGRDLCSKVATAILDYSTKLIIKTETGPNETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENSELVLNVNRLKSLQKLYLFEQKGGENYLG
Ga0307384_1029828413300031738MarineKIMKFTVVIAALLLSSAEAVTSLRKHRHPHRHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSGDDELVLAVNRLKSL
Ga0307384_1032949113300031738MarineKFTVVLAALLFSSAEATHSLKRHHRHPHGVQYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEIINSDLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQFQDNMGGLGMGGDDELVLAVNRLKSL
Ga0307384_1045586513300031738MarineKFYQILALIAATQAVSITTLPDVRPDTVADADIAAHEAARAEAAKVKKNPQTALLESIRVDLEQINKDLSFGVSFSQGKRNDHAKELVTKVSSAILDYANKLIAKVDTASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMAVNGDLNLSVNRLKSLQKLYLFEQKGGENYLG
Ga0307383_1034042113300031739MarineKFLSIAAIAMLCASTQAISITTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADVEQINKDLSFGVSFSQTARNDHAKELVTKASTAILGYANALIAKVDSASDETLTEQNAHNISAMIFYDVQVNDASNALAMPANSDLNLAINRLKSLQKLYLFEQKGGENYLG
Ga0307383_1036255423300031739MarineLIEIMKFLSVAMLLATTSAISRVPQYRSFVSTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHAKELVTKAGTAILGYANALIAKVDSASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLG
Ga0307383_1038459523300031739MarineFTVILAALLFSSAQAAQLTSLKRHHRHPHGHEFVATLPDVRADTVADTDIAANETARADAAKVKKNPQSALLQTLKADLEAINADLSFGISFSQTKRNDHARETCQKVAKAIKDYTSKLLAKIESAPNEVLTEQNAHNIAAVIFYDV
Ga0307383_1043116513300031739MarineMKFLKLSALLIVANAISITTLPDVRPDTVADADIAAHESARAEAAKVKKNPQSALLESIRTDLEQINKDLSFGVSFSQGKRNDHAKELVNKVSSAILDYAAKLVAKVDTASDETLTEQNAHNIAAMVFYDVQVEDAAASLGMEKNGDLQLAVNRLKSLQKLYLLE
Ga0307383_1068095213300031739MarineFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHESARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATSLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQ
Ga0307395_1039366613300031742MarineSLALTIIAIIAATTQAISITTLPDVRADTVADADIAAHEAARAEAAKVKKNPQTALLTSIRADLEQINKDLSFGISFSQGKRNDHAKELVSKVSTAILDYAGKLISKVDGASDETLTEQNAHNIAAMIFYDVQVQDAAAALGMAANGDLNLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307395_1054288013300031742MarineKLFSLSAIALLIASTDAANLNRHIKGVTFVQTLPDVRADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNTRNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKGLGMDQDKELVLAVNRLKS
Ga0307382_1021172013300031743MarineINKIMKFTVVIAALLLSSAEAVTSLRKHRHPHRHEYLATLPDVRADTVADADIAAHESARAEAAKVKKNPQSALLQTIKADLEAINSDLSFGISFSQTKKNDHARETCQKVGKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMSGDDELVLAVNRLKSL
Ga0307382_1030921823300031743MarineLIEIMKFLSVSMLLATTSAISRVPQYRSFVSTLPDVRDDTVADADIAAHEAARKEAALVKKNPQTALLDSVRADLEQINKDLSFGVSFSQTARNDHAKELVTKAGTAILGYANALIAKVDSASDETLTEQNAHNIAAMIFYDVQVQDAANALAMPANSDLSLAINRLKSLQKLYLFEQKGGENYLG
Ga0307382_1038253913300031743MarineKFLNLSAIAMLLASAEATQLNSLRHHRHIYDRQYIATLPDVRADTVADADIEAHESARAEAAKVKKNPQQALLNSIRADLEQINKDLSFGVSFSQGARNEHAKELVTKAGSSILDYANKLIAKVESASDETLTEQNAHNIAAMIFYDVQVQDAGNSLGMAPVGELNLAVNRLKSLQKLYLFEQKGGENYLGXATXFMXYKNYKQSVKKYITL
Ga0307404_1023371913300031752MarineLSTIALLVASSEAANISRHNIKGVTFVQTLPDVRADTVTEKDIAAHEASRADAAKVKKNPQSALLTSIRTDLESINYDLSFGVSFSQNTRNNRAKALATKIANAVKDYANKLIGTVDKSPNDALTEQNAHNIASMIFYDVQLEDNMRELGLDEDKELVLAVNRLKSLQKLYLFEQKGGENYLS
Ga0307404_1024667513300031752MarineKFFTYTIAVAALIASAEAANLSSLRRHRHHPSHMEFVSTLPDVRPDTVTEEDIASHESARSEAAKVKKNPQAALLASMKTDLEQVNKDMSFGISFSQTKRNDHARELCTKVGAAIEDYSSKLLGKVESGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0315316_1066845713300032011SeawaterSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLGXVR
Ga0314779_101420713300032150SedimentKFFTYCALIAATVAVQRHHNHHPHSVEFVATLPDVRADTVSDEDIAAHEAARSEAAKIKKNPQAELLATIRADLDQISKDLSFGVSYSQAKRNDHARALCTKVGTAILGYADGITAQVEAKTNESMTELNAHNISGMIFYDVQLQEFMNGLGMASNDALILAVNRFKSLQKLYLFEQKGGENYLG
Ga0314779_102762313300032150SedimentKFMSLSAFALLIASTEAANINRHNIKGVTFLQTLPDVRSDTVNEKDIVAHEKARSDAAKVKKNPQSSLLESMRTDLEAINHEISFGVSFSQNNRNNRGRALCKKVGGAVKEYANKLIDVVEKQPNEALTEQNAHNIASMIFHDVQLEDSMKELGMDEDKELQLAVNRLKSLQKLYLFEQKGGENYLE
Ga0314684_1041144813300032463SeawaterLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYL
Ga0314684_1050585013300032463SeawaterFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314670_1051724913300032470SeawaterKFLTYSTIAIALLLAPSNGTMLSRRHHHYGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314668_1030618113300032481SeawaterFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314668_1038908113300032481SeawaterKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314675_1037508013300032491SeawaterKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314675_1043907413300032491SeawaterALLVNDSSATKISTLPDVRADTVSDEDIAAHEAARSEAAKVTKNPQSQLLASIKTDLDQISKDLSFGISFSQTKRNDHARELCTKVSGSIQDYCSNLLTTTEAGPEETLTEQNAANMASIIFYDVQLQDAMKGLGMPEQGELVLAINRMKSLQKLYLFEQKGGENYLG
Ga0314679_1028090813300032492SeawaterKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314688_1032977113300032517SeawaterLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314688_1049720913300032517SeawaterPHSYQYVSTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQQSVLATIKTDLDQISKDLSFGVSYSQAKRNDHARELCTKVQTAIEGYASSLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGVSASDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314689_1038433213300032518SeawaterLTSTAVALLIASSEAASLSAMRHHHPSHYEYIYTLPDVRADTVSYEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQAKRNDHARELCTKVQTAIEGYASSLLTTIEAGPNETLTEQNAHNIAAMIFYDVQLQDFMTGLGVSASDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314689_1044465613300032518SeawaterLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314689_1047989913300032518SeawaterKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0314676_1039390213300032519SeawaterNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314667_1040789613300032520SeawaterFKIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314680_1068003713300032521SeawaterKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINTAMSFGISYSQTKRNDTARDTCTKVGASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314680_1070873413300032521SeawaterKIMKFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0314677_1046313923300032522SeawaterVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314674_1045755713300032615SeawaterAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0314671_1046029113300032616SeawaterHVELVSTLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314671_1073606113300032616SeawaterSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQTKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314683_1056657313300032617SeawaterFKIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314683_1078467913300032617SeawaterSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314673_1060526123300032650SeawaterTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314685_1036349613300032651SeawaterNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314685_1046938913300032651SeawaterKIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314678_1028457513300032666SeawaterFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314678_1033434213300032666SeawaterYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314687_1031747513300032707SeawaterCICQRDGACGSDGQRGLAMDVTVESGALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314687_1041148413300032707SeawaterMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314687_1042697313300032707SeawaterKFLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNSVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314687_1060438513300032707SeawaterTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETAASETLTEQNAHNIAAVIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314669_1042274113300032708SeawaterIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314669_1052195913300032708SeawaterVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314672_121158113300032709SeawaterHHPHHVELVSTLPDVRADTVSDEDIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLGXESXGVLATLLETEMLTM
Ga0314681_1036955413300032711SeawaterMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFMLCVESQ
Ga0314681_1055574913300032711SeawaterTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDSMAGLGMSENTELVLAVNRMKSL
Ga0314690_1046687313300032713SeawaterVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314690_1058655113300032713SeawaterIAAHELARAEAAKALKNPQSQVLATIKTDLDQISKDLSFGVSYSQEKRNDHARELCTKVATAIEGYASNLITTVEAGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGVAAPDDLVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314693_1035748413300032727SeawaterAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314693_1038158113300032727SeawaterMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314711_1037650513300032732SeawaterFFKIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314706_1024431423300032734SeawaterMPLFEGEATKSVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314706_1061774813300032734SeawaterRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0314707_1041588813300032743SeawaterKIMKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314707_1062747113300032743SeawaterVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQVQDFMTGLGQSAPDDLVLAVNRLKTLQKLYLFEQKGGENYLG
Ga0314705_1045967123300032744SeawaterLTSTAVALLIASSEAASLSAMRHHHPSHYEYISTLPDVRADTVSDEDIAAHEAARAEAAKALKNPQNTVLATIKTDLDQISKDLSFGVSYSQSTRNDHARTLTTKVATAITDYATNLLATVESGPNETMTEQNAHNIAAMIFYDVQLQDFMTGLGKSAPDELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0314704_1032551913300032745SeawaterAEEAAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLG
Ga0314701_1020399713300032746SeawaterFNLPLNMKYTAAALLAVALLVSDASAFRLETLPDVRADTVSDEDIAAHEAARAEASKTKKNPQATLLASVKTDLEQISKDLSFGISFSQSKRNDHARELCTKVANSIQDYTSTLLATTESGPEETLTEQNAANIASVLFYDVQLQDSMKGLGMPENGELVLAMNRMKSLQKLYLFEQKGGENYLGXVISEGPRPLSKLXNQYE
Ga0314701_1033624213300032746SeawaterVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINGAMSFGVSYSQTKRNDTARDTCTKVAASILDYANKLIGKVESASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314701_1037746713300032746SeawaterIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314701_1044491313300032746SeawaterFTVVLAALLFSSAEAAQLTSLRRHHRHPHGHEYLATLPDVRADTVADADIAAHEAARSEAAKVKKNPQAALLQTIKADLEAINADLSFGISFSQTKKNDHARETCQKVAKAIKDYTSKLLAKVEASPNEILTEQNAHNIAAVIFYDVQLQDNMAGLGMGGDDELVLAVNRLKSL
Ga0314713_1022760913300032748SeawaterMKFFTYTIAVAALVASADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLGXSXMSFVLCVESQ
Ga0314691_1043496013300032749SeawaterKFLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314694_1040728713300032751SeawaterKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIVDADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314700_1041320113300032752SeawaterIMKFVTFSTIAIALLMAPSNATKISRRHHHHGHEFVSTLPDVRPDTIADADIAAHEAARAEAAKVKKNPQAALLASIKADLEAINNNMSFGISYSQAKRNDTARDTCTKVAASILDYANKLIGKVETASTETLTEQNAHNIAAIIFYDVQLQDAMAGLGMSENTELVLAVNRMKSL
Ga0314700_1054587613300032752SeawaterLTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQL
Ga0314692_1055272013300032754SeawaterTYSTIAIALLLAPSNGTMLSRRHHHHGHEFVSTLPDVRPDTIADADIAAHESARAEAAKVKKNPQAALLASIKADLEAINGNMSFGISYSQTKRNDTARDTCTKVSASILDYANKLIDKVETAPTETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENTELVLAVNRMKSL
Ga0314709_1044495813300032755SeawaterMKFFTYTIAVAALVTSADAAAVSSLRRHRHHPSHNEFVSTLPDVRPDTVTEEDIAAHESARNEAAKVKKNPQAALLASMKTDLEQINKDMSFGISFSQTKRNDHARELCTKVGAAIEDYASKLLGKIETGPNETLTEQNAHNMAAVIFYDVQLQDAMKGLGMAGNGELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0310342_10116012023300032820SeawaterVRPDTVSDADIAAHEAARSEAARVKKNPQAALLASIKADLEAINTNMSFGVSYSQTKRNDTARDLCTKVGASVLGYATNLIAKVESGPNETLTEQNAHNIAAVIFYDVQLQDAMAGLGMAENADLVLAINRLKSLQKLYLFEQQGGENYLG
Ga0307390_1066017113300033572MarineADTVTEADIVAHEKARADAAKVKKNPQTGLLQSIRTDLETMNNDLSFGVSFSQNTRNNRAKAMVTKISNAIKEYAKKLIDTVNKSPDDALTEQNAHNIASMIFYDVQLEDNMKGLGMDQDKELVLAVNRLKSLQKLYLFEQKGGENYLG
Ga0307390_1083544013300033572MarineTMKFTVVIAALLFSSAQAAQLTSLRRHHAHRPHGHAYVATLPDVRADTVADADIAAHEAARAEAAKVKKNPQSALLQTIKADLEAINADLSFGISFSQTKRNDHARETVQKVSKAIKDYTSKLLAKIETGPNEVLTEQNAHNIASMIFYDVQVQDAANALAMPANGDLNLAVNRLKSLQKLYLFEQKGGENYL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.